DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PABPN1 and CstF64

DIOPT Version :10

Sequence 1:NP_004634.1 Gene:PABPN1 / 8106 HGNCID:8565 Length:306 Species:Homo sapiens
Sequence 2:NP_477453.1 Gene:CstF64 / 42239 FlyBaseID:FBgn0027841 Length:419 Species:Drosophila melanogaster


Alignment Length:79 Identity:28/79 - (35%)
Similarity:48/79 - (60%) Gaps:1/79 - (1%)


- Green bases have known domain annotations that are detailed below.


Human   167 MEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLA 231
            |:...||::|||:.|.||.|:|:..|...|.|..:.::.|:.||.||||.:.|:.|:|:..:::.
  Fly    11 MDKSMRSVFVGNIPYEATEEKLKEIFSEVGPVLSLKLVFDRESGKPKGFGFCEYKDQETALSAMR 75

Human   232 -LDESLFRGRQIKV 244
             |:.....||.::|
  Fly    76 NLNGYEIGGRTLRV 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PABPN1NP_004634.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..115
Interaction with SKIP. /evidence=ECO:0000269|PubMed:11371506 2..145
GCG-encoded polyalanine repeat 2..7
Stimulates PAPOLA. /evidence=ECO:0000250 119..147
Necessary for homooligomerization 155..306 28/79 (35%)
RRM_II_PABPN1 173..248 CDD:409966 26/73 (36%)
Interaction with PAPOLA. /evidence=ECO:0000250 286..306
CstF64NP_477453.1 RRM_CSTF2_CSTF2T 10..94 CDD:410072 28/79 (35%)
CSTF2_hinge 111..190 CDD:433869
CSTF_C 377..416 CDD:464130
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.