DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PABPN1 and CG11726

DIOPT Version :10

Sequence 1:NP_004634.1 Gene:PABPN1 / 8106 HGNCID:8565 Length:306 Species:Homo sapiens
Sequence 2:NP_648461.1 Gene:CG11726 / 39275 FlyBaseID:FBgn0036156 Length:291 Species:Drosophila melanogaster


Alignment Length:183 Identity:47/183 - (25%)
Similarity:75/183 - (40%) Gaps:30/183 - (16%)


- Green bases have known domain annotations that are detailed below.


Human   105 VEGDPGDGAIEDPELEAIKARVREMEEEAEKL------KELQNEVEKQMNMSPPPGNAGPVIMSI 163
            |.|......:|| .|...|.|..:: :.||..      |:..::::|::: :|.|          
  Fly    24 VSGSESGQGLED-MLHVTKVRTSQV-DNAELFMYGDGPKKSNSDLQKKVS-TPDP---------- 75

Human   164 EEKMEADARSI-YVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVR 227
            ||::..:...: .|.|:....|..||...|... |:..:||  .|....||||||:|...:|.:.
  Fly    76 EEEVSMEPPFVALVSNLPMECTEGELRKVFTSF-SIRSLTI--PKKGKRPKGFAYVEMDSREDLV 137

Human   228 TSLALDESLFRGR----QIKVIPKRTNRPGISTTDRGFPRARYRARTTNYNSS 276
            ..|.:|:...|||    :|..:|.   .|.......||.......|..:.|||
  Fly   138 RLLKMDKLKCRGRCLMAKIGQLPP---EPPTKAAGDGFSLFTCSGRQFDINSS 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PABPN1NP_004634.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..115 2/9 (22%)
Interaction with SKIP. /evidence=ECO:0000269|PubMed:11371506 2..145 10/45 (22%)
GCG-encoded polyalanine repeat 2..7
Stimulates PAPOLA. /evidence=ECO:0000250 119..147 7/33 (21%)
Necessary for homooligomerization 155..306 34/127 (27%)
RRM_II_PABPN1 173..248 CDD:409966 25/79 (32%)
Interaction with PAPOLA. /evidence=ECO:0000250 286..306
CG11726NP_648461.1 RRM_SF 83..150 CDD:473069 21/69 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.