DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PABPN1 and lark

DIOPT Version :10

Sequence 1:NP_004634.1 Gene:PABPN1 / 8106 HGNCID:8565 Length:306 Species:Homo sapiens
Sequence 2:NP_523957.1 Gene:lark / 38811 FlyBaseID:FBgn0011640 Length:352 Species:Drosophila melanogaster


Alignment Length:199 Identity:46/199 - (23%)
Similarity:79/199 - (39%) Gaps:50/199 - (25%)


- Green bases have known domain annotations that are detailed below.


Human   129 MEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARS----------IYVGNVDYGA 183
            ||.|.:....:||     :|        |..:.....|:|| |:|          |:|||:....
  Fly    47 METEQQGRDAIQN-----LN--------GYTLNEFAIKVE
A-AKSRRAPNTPTTKIFVGNLTDKT 97

Human   184 TAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIE-FSD-KESVRTSLALDESLFRGRQIKVIP 246
            .|.|:...|...|:|    :.||....:  ||.::: ..| :::::   .|:..:..|:.:||..
  Fly    98 RAPEVRELFQKYGTV----VECDIVRNY--GFVHLDCVGDVQDAIK---ELNGRVVDGQPLKVQV 153

Human   247 KRTN---RPGISTTDRGFPRARYR-ARTTNYNSSRSRFY--SGFNSRPRGRV----YRGRARATS 301
            ..:.   :||:     |.|...|| .|:.:::....|.|  :|....|...:    ||.|.....
  Fly   154 STSRVRPKPGM-----GDPEQCYRCGRSGHWSKECPRLYGSAGGGREPPSPLSAGGYRDRMYGRD 213

Human   302 WYSP 305
            .|.|
  Fly   214 PYPP 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PABPN1NP_004634.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..115
Interaction with SKIP. /evidence=ECO:0000269|PubMed:11371506 2..145 5/15 (33%)
GCG-encoded polyalanine repeat 2..7
Stimulates PAPOLA. /evidence=ECO:0000250 119..147 5/17 (29%)
Necessary for homooligomerization 155..306 40/173 (23%)
RRM_II_PABPN1 173..248 CDD:409966 19/86 (22%)
Interaction with PAPOLA. /evidence=ECO:0000250 286..306 6/24 (25%)
larkNP_523957.1 RRM1_2_CoAA_like 8..73 CDD:409779 8/38 (21%)
RRM1_2_CoAA_like 87..152 CDD:409779 17/73 (23%)
hnRNP-R-Q <88..>258 CDD:273732 34/144 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.