DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PABPN1 and Pabp2

DIOPT Version :9

Sequence 1:NP_004634.1 Gene:PABPN1 / 8106 HGNCID:8565 Length:306 Species:Homo sapiens
Sequence 2:NP_476902.1 Gene:Pabp2 / 35788 FlyBaseID:FBgn0005648 Length:224 Species:Drosophila melanogaster


Alignment Length:218 Identity:128/218 - (58%)
Similarity:156/218 - (71%) Gaps:20/218 - (9%)


- Green bases have known domain annotations that are detailed below.


Human    94 GSQEEE-----EEPGLVEGDPGDGAIEDPELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPP 153
            |.||.|     ||.|.::        .|||||||||||:||||||||:|::|:||:|||......
  Fly    22 GEQETEIATEVEEEGSMQ--------IDPELEAIKARVKEMEEEAEKIKQMQSEVDKQMAGGSTT 78

Human   154 GNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYI 218
            |.| .|.:|:|||.|.|.||:|||||||||:||||||||||||::|||||||:|..|||||||||
  Fly    79 GLA-TVPLSLEEKQEIDTRSVYVGNVDYGASAEELEAHFHGCGTINRVTILCNKADGHPKGFAYI 142

Human   219 EFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSG 283
            ||..||.|.|:||::|:|||||||||:.|||||||:|||:| |.|..:|.|....  ||:..:|.
  Fly   143 EFGSKEFVETALAMNETLFRGRQIKVMSKRTNRPGLSTTNR-FARGSFRGRGARV--SRACCHST 204

Human   284 FNSRPRGRVYRGRARATSWYSPY 306
            |....|...|||||   ::|:||
  Fly   205 FRGARRAMGYRGRA---NYYAPY 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PABPN1NP_004634.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..115 7/25 (28%)
Interaction with SKIP. /evidence=ECO:0000269|PubMed:11371506 2..145 30/55 (55%)
GCG-encoded polyalanine repeat 2..7
RRM 113..>289 CDD:223796 112/175 (64%)
Stimulates PAPOLA. /evidence=ECO:0000250 119..147 21/27 (78%)
Necessary for homooligomerization 155..306 92/150 (61%)
RRM_II_PABPN1 173..248 CDD:409966 57/74 (77%)
Interaction with PAPOLA. /evidence=ECO:0000250 286..306 7/19 (37%)
Pabp2NP_476902.1 RRM <43..>172 CDD:223796 91/129 (71%)
RRM_II_PABPN1 97..172 CDD:240994 57/74 (77%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165150027
Domainoid 1 1.000 123 1.000 Domainoid score I5604
eggNOG 1 0.900 - - E1_KOG4209
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3412
Inparanoid 1 1.050 230 1.000 Inparanoid score I3448
Isobase 1 0.950 - 0 Normalized mean entropy S1069
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1412946at2759
OrthoFinder 1 1.000 - - FOG0001228
OrthoInspector 1 1.000 - - oto91785
orthoMCL 1 0.900 - - OOG6_101686
Panther 1 1.100 - - LDO PTHR23236
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4120
SonicParanoid 1 1.000 - - X689
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.740

Return to query results.
Submit another query.