DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PABPN1 and CG11454

DIOPT Version :10

Sequence 1:NP_004634.1 Gene:PABPN1 / 8106 HGNCID:8565 Length:306 Species:Homo sapiens
Sequence 2:NP_608497.1 Gene:CG11454 / 33175 FlyBaseID:FBgn0031224 Length:238 Species:Drosophila melanogaster


Alignment Length:135 Identity:32/135 - (23%)
Similarity:55/135 - (40%) Gaps:28/135 - (20%)


- Green bases have known domain annotations that are detailed below.


Human   152 PPGNAGPVIMSIE----EKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHP 212
            |..|...::..:|    |:.:.:.|:::.||:|...|.|.|...|...|.:..|.|..|. :|.|
  Fly    46 PNENGDQLVGQLEDDDDEEEDEEQRTLFCGNLDERVTEEILYEVFLQAGPIEGVRIPTDN-NGRP 109

Human   213 KGFAYIEFSDKESVRTSLALDESLFRGRQI---KVIPKRTNRPGISTTDRGFPRARYRARTTNYN 274
            :.|.::.:  :.......|||  |::|.::   ||..|:.....:..                ||
  Fly   110 RNFGFVTY--QRLCAVPFALD--LYQGLELFQKKVTIKQQGGKQLPA----------------YN 154

Human   275 SSRSR 279
            .||.|
  Fly   155 QSRLR 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PABPN1NP_004634.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..115
Interaction with SKIP. /evidence=ECO:0000269|PubMed:11371506 2..145
GCG-encoded polyalanine repeat 2..7
Stimulates PAPOLA. /evidence=ECO:0000250 119..147
Necessary for homooligomerization 155..306 31/132 (23%)
RRM_II_PABPN1 173..248 CDD:409966 21/77 (27%)
Interaction with PAPOLA. /evidence=ECO:0000250 286..306
CG11454NP_608497.1 RRM_RBM7_like 69..143 CDD:409773 22/78 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.