DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CALML3 and Calml3

DIOPT Version :9

Sequence 1:NP_005176.1 Gene:CALML3 / 810 HGNCID:1452 Length:149 Species:Homo sapiens
Sequence 2:NP_081692.1 Gene:Calml3 / 70405 MGIID:1917655 Length:149 Species:Mus musculus


Alignment Length:149 Identity:133/149 - (89%)
Similarity:144/149 - (96%) Gaps:0/149 - (0%)


- Green bases have known domain annotations that are detailed below.


Human     1 MADQLTEEQVTEFKEAFSLFDKDGDGCITTRELGTVMRSLGQNPTEAELRDMMSEIDRDGNGTVD 65
            |||||||||:.|||||||||||||||.|||:||||||||||||||||||:.|::|||:|||||||
Mouse     1 MADQLTEEQIAEFKEAFSLFDKDGDGSITTQELGTVMRSLGQNPTEAELQGMVNEIDKDGNGTVD 65

Human    66 FPEFLGMMARKMKDTDNEEEIREAFRVFDKDGNGFVSAAELRHVMTRLGEKLSDEEVDEMIRAAD 130
            |||||.||:|||||||:|||||||||||||||||||||||||||||:||||||||||||||:|||
Mouse    66 FPEFLTMMSRKMKDTDSEEEIREAFRVFDKDGNGFVSAAELRHVMTKLGEKLSDEEVDEMIQAAD 130

Human   131 TDGDGQVNYEEFVRVLVSK 149
            |||||||||||||.:||||
Mouse   131 TDGDGQVNYEEFVHMLVSK 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CALML3NP_005176.1 PTZ00184 1..149 CDD:185504 131/147 (89%)
Calml3NP_081692.1 PTZ00184 1..149 CDD:185504 131/147 (89%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C83964699
Domainoid 1 1.000 121 1.000 Domainoid score I40387
eggNOG 1 0.900 - - E33208_3BQQ5
HGNC 1 1.500 - -
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H133078
Inparanoid 1 1.050 270 1.000 Inparanoid score I15478
Isobase 00.000 Not matched by this tool.
NCBI 1 1.000 - -
OMA 1 1.010 - - QHG53747
OrthoDB 1 1.010 - - D1386217at2759
OrthoFinder 1 1.000 - - FOG0000535
OrthoInspector 1 1.000 - - oto113497
orthoMCL 1 0.900 - - OOG6_148472
Panther 1 1.100 - - LDO PTHR23050
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R162
SonicParanoid 1 1.000 - - X199
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1919.300

Return to query results.
Submit another query.