DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KMT2D and SET2

DIOPT Version :9

Sequence 1:XP_011537072.1 Gene:KMT2D / 8085 HGNCID:7133 Length:5556 Species:Homo sapiens
Sequence 2:NP_012367.2 Gene:SET2 / 853271 SGDID:S000003704 Length:733 Species:Saccharomyces cerevisiae


Alignment Length:150 Identity:49/150 - (32%)
Similarity:85/150 - (56%) Gaps:8/150 - (5%)


- Green bases have known domain annotations that are detailed below.


Human  5406 QYRRLRTEWKNNVYLARSRIQGLGLYAAKDLEKHTMVIEYIGTIIRNEVANRREKI--YEEQN-R 5467
            |.:|.:.:....:.:.:::.:|.|:.|.:|:|.:..:.||.|.:|  |....|:::  |:::: :
Yeast   110 QNQRFQKKQYAPIAIFKTKHKGYGVRAEQDIEANQFIYEYKGEVI--EEMEFRDRLIDYDQRHFK 172

Human  5468 GIYMFRINNEHVIDATLTGGPARYINHSCAPNC-VAEVVTFDKEDKIIIISSRRIPKGEELTYDY 5531
            ..|...:.|...||||:.|..||:.||||:||. |.:.|..||. ::.|.:.|:|.||||:|:||
Yeast   173 HFYFMMLQNGEFIDATIKGSLARFCNHSCSPNAYVNKWVVKDKL-RMGIFAQRKILKGEEITFDY 236

Human  5532 QFDFEDDQHKIPCHCGAWNC 5551
            ..|....|.: .|:|...||
Yeast   237 NVDRYGAQAQ-KCYCEEPNC 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KMT2DXP_011537072.1 None
SET2NP_012367.2 AWS 64..119 CDD:197795 2/8 (25%)
SET_SETD2 119..260 CDD:380949 46/140 (33%)
SET 215..695 CDD:225491 16/42 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4489
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.