DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CALM3 and CG11041

DIOPT Version :10

Sequence 1:NP_005175.2 Gene:CALM3 / 808 HGNCID:1449 Length:149 Species:Homo sapiens
Sequence 2:NP_611453.2 Gene:CG11041 / 37278 FlyBaseID:FBgn0034481 Length:155 Species:Drosophila melanogaster


Alignment Length:146 Identity:48/146 - (32%)
Similarity:81/146 - (55%) Gaps:10/146 - (6%)


- Green bases have known domain annotations that are detailed below.


Human     7 EEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDA-DGNGTIDFPEFL 70
            |::|:   :||.:||..||..|..:|:|||:|.||..|||.|:.::|:..:: :.:|.:...:||
  Fly    10 EKRIS---DAFCVFDHHGDKFIDVREVGTVLRLLGCVPTEEEVNEVISATESEETSGEVHLTKFL 71

Human    71 -----TMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREAD 130
                 .:|.|||:.. ..|:|.:||::.|.:..||::......:|...||..|.||:|||...|.
  Fly    72 PHVSQLLMERKMEPA-PPEKILQAFKILDPENKGYLTKESFGKLMMEEGEPFTQEEMDEMWPVAI 135

Human   131 IDGDGQVNYEEFVQMM 146
            ....|.:.||.::..:
  Fly   136 DPISGHIPYEFYLNQL 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CALM3NP_005175.2 PTZ00184 1..149 CDD:185504 48/146 (33%)
Necessary and sufficient for interaction with PCP4. /evidence=ECO:0000269|PubMed:27876793 77..149 21/70 (30%)
CG11041NP_611453.2 PTZ00184 15..152 CDD:185504 46/138 (33%)

Return to query results.
Submit another query.