DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CALM3 and CG11638

DIOPT Version :10

Sequence 1:NP_005175.2 Gene:CALM3 / 808 HGNCID:1449 Length:149 Species:Homo sapiens
Sequence 2:NP_569879.1 Gene:CG11638 / 31050 FlyBaseID:FBgn0040351 Length:387 Species:Drosophila melanogaster


Alignment Length:98 Identity:24/98 - (24%)
Similarity:40/98 - (40%) Gaps:24/98 - (24%)


- Green bases have known domain annotations that are detailed below.


Human    75 PAWFLLASPK---YSQV--------PAPAQIRDPEAGLQEPPEEEEEEEEEEEEETEEKGDEEDT 128
            |||.|....|   |:.|        ||.:.|:.|   :.:|......:...:|::.:.|.|:.||
  Fly    22 PAWILCKGKKKATYASVSKQTSSAEPAKSAIKPP---ITDPTPSAMAKVGSDEKKEDPKDDKGDT 83

Human   129 SSACEEG-------MDSSS---PQPGSPTSHRR 151
            .|...:|       :|.|.   |:...||..::
  Fly    84 KSPVPDGGAADAKPVDQSQKPFPKFEMPTESKK 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CALM3NP_005175.2 PTZ00184 1..149 CDD:185504 24/94 (26%)
Necessary and sufficient for interaction with PCP4. /evidence=ECO:0000269|PubMed:27876793 77..149 22/92 (24%)
CG11638NP_569879.1 PTZ00184 210..352 CDD:185504
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.