DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CALM3 and calm2

DIOPT Version :9

Sequence 1:NP_001316851.1 Gene:CALM3 / 808 HGNCID:1449 Length:149 Species:Homo sapiens
Sequence 2:NP_001363414.1 Gene:calm2 / 100496298 XenbaseID:XB-GENE-976642 Length:149 Species:Xenopus tropicalis


Alignment Length:149 Identity:149/149 - (100%)
Similarity:149/149 - (100%) Gaps:0/149 - (0%)


- Green bases have known domain annotations that are detailed below.


Human     1 MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTID 65
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
 Frog     1 MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTID 65

Human    66 FPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREAD 130
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
 Frog    66 FPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREAD 130

Human   131 IDGDGQVNYEEFVQMMTAK 149
            |||||||||||||||||||
 Frog   131 IDGDGQVNYEEFVQMMTAK 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CALM3NP_001316851.1 PTZ00184 1..149 CDD:185504 147/147 (100%)
Necessary and sufficient for interaction with PCP4. /evidence=ECO:0000269|PubMed:27876793 77..149 71/71 (100%)
calm2NP_001363414.1 PTZ00184 1..149 CDD:185504 147/147 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 131 1.000 Domainoid score I24070
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 296 1.000 Inparanoid score I10676
NCBI 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1386217at2759
OrthoFinder 1 1.000 - - FOG0000535
OrthoInspector 1 1.000 - - oto155987
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X199
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.060

Return to query results.
Submit another query.