DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYB5B and CG5157

DIOPT Version :10

Sequence 1:NP_085056.2 Gene:CYB5B / 80777 HGNCID:24374 Length:150 Species:Homo sapiens
Sequence 2:NP_648843.1 Gene:CG5157 / 39771 FlyBaseID:FBgn0036575 Length:119 Species:Drosophila melanogaster


Alignment Length:113 Identity:52/113 - (46%)
Similarity:68/113 - (60%) Gaps:17/113 - (15%)


- Green bases have known domain annotations that are detailed below.


Human    27 YRLEEVAKRNSL--KELWLVIHGRVYDVTRFLNEHPGGEEVLLEQAGVDASESFEDVGHSSDARE 89
            |.|.|||::|..  |..||:|.|.|||||:||.|||||.|.|||..|.||:::|:..||||||.:
  Fly     5 YELSEVAQQNGKNGKPCWLIIKGNVYDVTKFLGEHPGGSEALLEYGGKDATKAFKQAGHSSDAEK 69

Human    90 MLKQYYIGDIH---PSDLKPESG----------SKD--PSKNDTCKSC 122
            .||.|.||:|:   |..::|.|.          |:|  |:||.:...|
  Fly    70 DLKNYKIGEINSAAPIQVQPTSNGAAKPTANTISEDPEPAKNSSSGFC 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CYB5BNP_085056.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
Cyt-b5 28..100 CDD:459698 41/73 (56%)
MIP <123..148 CDD:444743 52/113 (46%)
CG5157NP_648843.1 Cyt-b5 7..79 CDD:459698 41/71 (58%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.