DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYB5B and CG11257

DIOPT Version :10

Sequence 1:NP_085056.2 Gene:CYB5B / 80777 HGNCID:24374 Length:150 Species:Homo sapiens
Sequence 2:NP_611419.1 Gene:CG11257 / 37227 FlyBaseID:FBgn0034442 Length:535 Species:Drosophila melanogaster


Alignment Length:103 Identity:32/103 - (31%)
Similarity:60/103 - (58%) Gaps:7/103 - (6%)


- Green bases have known domain annotations that are detailed below.


Human     8 AEASGSDGKGQEVETSVTYYRLEEVAKRNSLKELWLVIHGRVYDVTRFLNEHPGGEEVLLEQAGV 72
            |:.||:.|:...|..:       |:|:.|.:.:.|:.|.|||::|||:::.||||.:.|:...|.
  Fly    78 ADLSGTGGRLVPVSRT-------ELARHNKIDDAWMAIRGRVFNVTRYMDFHPGGVDELMRGVGR 135

Human    73 DASESFEDVGHSSDAREMLKQYYIGDIHPSDLKPESGS 110
            ||::.|::|....:..::|.:.|:|.:..::.||...|
  Fly   136 DATKLFDEVHAWVNYPQLLGKCYVGPLKDNETKPAKES 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CYB5BNP_085056.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20 4/11 (36%)
Cyt-b5 28..100 CDD:459698 24/71 (34%)
MIP <123..148 CDD:444743
CG11257NP_611419.1 Cyt-b5 91..163 CDD:459698 24/78 (31%)
p23_NCB5OR 190..276 CDD:107240
cyt_b5_reduct_like 295..533 CDD:99780
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.