DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYB5B and CG3566

DIOPT Version :10

Sequence 1:NP_085056.2 Gene:CYB5B / 80777 HGNCID:24374 Length:150 Species:Homo sapiens
Sequence 2:NP_572304.5 Gene:CG3566 / 31562 FlyBaseID:FBgn0029854 Length:117 Species:Drosophila melanogaster


Alignment Length:115 Identity:53/115 - (46%)
Similarity:74/115 - (64%) Gaps:12/115 - (10%)


- Green bases have known domain annotations that are detailed below.


Human    28 RLEEVAKRNSLKELWLVIHGRVYDVTRFLNEHPGGEEVLLEQAGVDASESFEDVGHSSDAREMLK 92
            ||..|.:.|...:||:||..:|||||:|..|||||||.|:::||.||:::|.||||||:||||||
  Fly     6 RLATVNEHNKATDLWVVIDNKVYDVTKFRLEHPGGEESLVDEAGRDATKAFNDVGHSSEAREMLK 70

Human    93 QYYIGDIHPSDLKPESGSKDPSKNDTCKSCWAYWILPIIGAVLLGFLYRY 142
            :|||||:..:|:|    .|.|.   :|:.     :...:||..:|....|
  Fly    71 KYYIGDLAAADIK----KKSPI---SCRH-----VALALGAAFIGISLVY 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CYB5BNP_085056.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
Cyt-b5 28..100 CDD:459698 44/71 (62%)
MIP <123..148 CDD:444743 4/20 (20%)
CG3566NP_572304.5 Cyt-b5 6..78 CDD:459698 44/71 (62%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.