DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PBX4 and hth

DIOPT Version :9

Sequence 1:XP_011526622.1 Gene:PBX4 / 80714 HGNCID:13403 Length:391 Species:Homo sapiens
Sequence 2:NP_476576.1 Gene:hth / 41273 FlyBaseID:FBgn0001235 Length:487 Species:Drosophila melanogaster


Alignment Length:156 Identity:48/156 - (30%)
Similarity:62/156 - (39%) Gaps:52/156 - (33%)


- Green bases have known domain annotations that are detailed below.


Human   228 RRKRRNFSKQATEVLNEYFYSHLNNPYPSEEAKEELARKGGLTISQVSNWFGNKRIRYKKNMGKF 292
            ::||..|.|.||.:|..:.:.||.:|||||:.|::||:..||||.||:|||.|.|.|..:.|.. 
  Fly   366 QKKRGIFPKVATNILRAWLFQHLTHPYPSEDQKKQLAQDTGLTILQVNNWFINARRRIVQPMID- 429

Human   293 QEEATIYTGKTAVDTTEVGVPGNHASCLSTPSSGSSGPFPLPSAGDAFLTLRTLASLQPPPGGGC 357
            |....:|                      ||..|.||     ...||.              |..
  Fly   430 QSNRAVY----------------------TPHPGPSG-----YGHDAM--------------GYM 453

Human   358 LQSQAQGSWQGATPQPATASPAGDPG 383
            :.|||.          ....|.||||
  Fly   454 MDSQAH----------MMHRPPGDPG 469

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PBX4XP_011526622.1 PBC 18..226 CDD:281746
homeodomain 228..289 CDD:238039 29/60 (48%)
hthNP_476576.1 Meis_PKNOX_N 127..211 CDD:406806
Homeobox_KN 383..422 CDD:399131 21/38 (55%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152636
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X78
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.