Sequence 1: | NP_005429.1 | Gene: | FOSL1 / 8061 | HGNCID: | 13718 | Length: | 271 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001027577.2 | Gene: | kay / 3772082 | FlyBaseID: | FBgn0001297 | Length: | 755 | Species: | Drosophila melanogaster |
Alignment Length: | 266 | Identity: | 70/266 - (26%) |
---|---|---|---|
Similarity: | 101/266 - (37%) | Gaps: | 93/266 - (34%) |
- Green bases have known domain annotations that are detailed below.
Human 91 GVRRRP--CEQISPEEEERRRVRRERNKLAAAKCRNRRKELTDFLQAETDKLEDEKSGLQREIEE 153
Human 154 LQKQKERLELVLEAHRPICK----------------IPEG-AKEGDTG----------------- 184
Human 185 ----------STSGTSSP-----------------------------------PAPCRPVPCISL 204
Human 205 SPGPVLEPEALHTPTLMTTPSL-TPFTPSLVFTYPSTPEPCASAHRKSSSSSGDPSSDPLG---- 264
Human 265 SPTLLA 270 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
FOSL1 | NP_005429.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..34 | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 68..112 | 10/22 (45%) | |||
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 | 107..127 | 14/19 (74%) | |||
bZIP_Fos | 115..168 | CDD:269869 | 22/52 (42%) | ||
coiled coil | 115..167 | CDD:269869 | 22/51 (43%) | ||
PRK13729 | 129..>250 | CDD:184281 | 39/200 (20%) | ||
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 | 133..161 | 9/27 (33%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 173..202 | 10/107 (9%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 237..271 | 11/38 (29%) | |||
kay | NP_001027577.2 | bZIP_Fos | 420..481 | CDD:269869 | 28/60 (47%) |
coiled coil | 421..480 | CDD:269869 | 28/58 (48%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1414 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0002314 | |
OrthoInspector | 1 | 1.000 | - | - | otm42280 | |
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR23351 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R103 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 1 | 0.960 | - | - | ||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
8 | 7.900 |