DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FOSL1 and kay

DIOPT Version :9

Sequence 1:NP_005429.1 Gene:FOSL1 / 8061 HGNCID:13718 Length:271 Species:Homo sapiens
Sequence 2:NP_001027577.2 Gene:kay / 3772082 FlyBaseID:FBgn0001297 Length:755 Species:Drosophila melanogaster


Alignment Length:266 Identity:70/266 - (26%)
Similarity:101/266 - (37%) Gaps:93/266 - (34%)


- Green bases have known domain annotations that are detailed below.


Human    91 GVRRRP--CEQISPEEEERRRVRRERNKLAAAKCRNRRKELTDFLQAETDKLEDEKSGLQREIEE 153
            |..|||  ...::||||::|.|||||||.|||:||.||.:.|:.|..|.::||.....:::|||.
  Fly   402 GGGRRPNRSTNMTPEEEQKRAVRRERNKQAAARCRKRRVDQTNELTEEVEQLEKRGESMRKEIEV 466

Human   154 LQKQKERLELVLEAHRPICK----------------IPEG-AKEGDTG----------------- 184
            |...|.:||.:|..||..|:                .|.| ...|.:|                 
  Fly   467 LTNSKNQLEYLLATHRATCQKIRSDMLSVVTCNGLIAPAGLLSAGSSGSGASSHHNHNSNDSSNG 531

Human   185 ----------STSGTSSP-----------------------------------PAPCRPVPCISL 204
                      ||..::||                                   |.|.:.:....:
  Fly   532 TITGMDATLNSTGRSNSPLDLKPAANIDSLLMHIKDEPLDGAIDSGSSLDQDGPPPSKRITLPPM 596

Human   205 SPGPVLEPEALHTPTLMTTPSL-TPFTPSLVFTYPSTPEPCASAHRKSSSSSGDPSSDPLG---- 264
            |..|.:....:.|||..::.|| ||.|       .:.|....||...:|:.|...:.:.:|    
  Fly   597 STMPHVHLSTILTPTGASSGSLQTPIT-------STAPGGFGSAFPVTSNGSSINNINSIGNNMN 654

Human   265 SPTLLA 270
            ||||.|
  Fly   655 SPTLNA 660

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FOSL1NP_005429.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..34
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 68..112 10/22 (45%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 107..127 14/19 (74%)
bZIP_Fos 115..168 CDD:269869 22/52 (42%)
coiled coil 115..167 CDD:269869 22/51 (43%)
PRK13729 129..>250 CDD:184281 39/200 (20%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 133..161 9/27 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 173..202 10/107 (9%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 237..271 11/38 (29%)
kayNP_001027577.2 bZIP_Fos 420..481 CDD:269869 28/60 (47%)
coiled coil 421..480 CDD:269869 28/58 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1414
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002314
OrthoInspector 1 1.000 - - otm42280
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23351
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R103
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
87.900

Return to query results.
Submit another query.