DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CALM2 and Eip63F-1

DIOPT Version :9

Sequence 1:NP_001292553.1 Gene:CALM2 / 805 HGNCID:1445 Length:197 Species:Homo sapiens
Sequence 2:NP_524902.2 Gene:Eip63F-1 / 47878 FlyBaseID:FBgn0004910 Length:193 Species:Drosophila melanogaster


Alignment Length:170 Identity:59/170 - (34%)
Similarity:98/170 - (57%) Gaps:19/170 - (11%)


- Green bases have known domain annotations that are detailed below.


Human    44 AQQPCKADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG 108
            |.:..|....||.:|.:.:.||.|.|::.||.:|..||..::::||.|.::..:.|:|.|....|
  Fly    23 ATKSVKKKPFTEVEIKDLRTAFDLLDRNRDGRVTANELQFMLKNLGINVSDELIHDLIREASHSG 87

Human   109 NGTIDFPEFLTMMAR------------KMKDT-------DSEEEIREAFRVFDKDGNGYISAAEL 154
            ||.|:..|||..:.|            ..||:       |..|::..||||||:||||:|:..||
  Fly    88 NGLINEAEFLQWVGRIQALRDEQHSHEDSKDSKPVDEADDVTEDLIAAFRVFDRDGNGFITRDEL 152

Human   155 RHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMM 194
            :..|..:||.|.::::::::..||:|.||::|||||.:::
  Fly   153 QTAMEMIGEPLNEQQLEQLLVIADLDQDGRINYEEFTRLL 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CALM2NP_001292553.1 PTZ00184 50..197 CDD:185504 57/164 (35%)
Eip63F-1NP_524902.2 PTZ00184 33..193 CDD:185504 57/160 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53747
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.