DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CSRP3 and Rassf

DIOPT Version :9

Sequence 1:	NP_003467.1	Gene:	CSRP3 / 8048	HGNCID:	2472	Length:	194	Species:	Homo sapiens
Sequence 2:	NP_651126.3	Gene:	Rassf / 42734	FlyBaseID:	FBgn0039055	Length:	806	Species:	Drosophila melanogaster

Alignment Length:	94	Identity:	33/94 - (35%)
Similarity:	46/94 - (48%)	Gaps:	6/94 - (6%)

- Green bases have known domain annotations that are detailed below.

Human     9 KCGACEKTVYHAEEIQCNGRSFHKTCFHCMACRKALDSTTVAAHESEIYCKV-CYGRRYGPKGIG 72
            ||..|.|.||.||..|..|..:|..|..|..|.|.|:....|.|:|..||.| |||..:||:..|
  Fly     3 KCHKCGKPVYFAERKQSIGYDWHPECLRCEECGKRLNPGQHAEHKSVPYCHVPCYGALFGPQLFG 67

Human    73 YGQGAGCLSTDTGEHLGLQFQQSPKPARS 101
            :|     ...::.:..|::..|.|..|::
  Fly    68 HG-----TRVESHKSYGVKGAQKPTGAQA 91

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CSRP3	NP_003467.1	Interaction with TCAP. /evidence=ECO:0000269\|PubMed:12507422	1..5
		LIM1_CRP3	9..62	CDD:188865	22/53 (42%)
		Nuclear localization signal. /evidence=ECO:0000250\|UniProtKB:P50463, ECO:0000255	64..69		1/4 (25%)
		Interaction with CLF2 and isoform 2. /evidence=ECO:0000269\|PubMed:19752190, ECO:0000269\|PubMed:24860983	94..105		3/8 (38%)
		LIM2_CRP3	120..173	CDD:188866
Rassf	NP_651126.3	LIM_TLP_like	4..57	CDD:188785	21/52 (40%)
		UBQ	660..744	CDD:294102
		Nore1-SARAH	762..799	CDD:293125
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	1	1.000	-	-		FOG0000284
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	2	1.910