DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CSRP3 and Mical

DIOPT Version :10

Sequence 1:NP_003467.1 Gene:CSRP3 / 8048 HGNCID:2472 Length:194 Species:Homo sapiens
Sequence 2:NP_001247015.1 Gene:Mical / 41225 FlyBaseID:FBgn0053208 Length:4743 Species:Drosophila melanogaster


Alignment Length:75 Identity:23/75 - (30%)
Similarity:32/75 - (42%) Gaps:7/75 - (9%)


- Green bases have known domain annotations that are detailed below.


Human   101 SVTTSNPSKFTAKF---GESEKCPRCGKSVYAAEKVMGGGKPWHKTCFRCAICGKSLE----STN 158
            :|...:.||....|   ..||||..|.::||..||....|...|:.|.:|..|..:|.    :.:
  Fly  1075 TVIPKSSSKVALAFKKQAASEKCRFCKQTVYLMEKTTVEGLVLHRNCLKCHHCHTNLRLGGYAFD 1139

Human   159 VTDKDGELYC 168
            ..|..|..||
  Fly  1140 RDDPQGRFYC 1149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CSRP3NP_003467.1 Interaction with TCAP. /evidence=ECO:0000269|PubMed:12507422 1..5
LIM1_CRP3 9..62 CDD:188865
Nuclear localization signal. /evidence=ECO:0000250|UniProtKB:P50463, ECO:0000255 64..69
Interaction with CLF2 and isoform 2. /evidence=ECO:0000269|PubMed:19752190, ECO:0000269|PubMed:24860983 94..105 1/3 (33%)
LIM2_CRP3 120..173 CDD:188866 16/53 (30%)
MicalNP_001247015.1 UbiH 128..>263 CDD:440419
CH_SF 567..669 CDD:469584
LIM_Mical 1097..1153 CDD:188823 16/53 (30%)
PRK10819 <1450..>1557 CDD:236768
bMERB_dom 4592..4705 CDD:463467
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.