DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CSRP3 and Mlp84B

DIOPT Version :9

Sequence 1:NP_003467.1 Gene:CSRP3 / 8048 HGNCID:2472 Length:194 Species:Homo sapiens
Sequence 2:NP_001303418.1 Gene:Mlp84B / 40849 FlyBaseID:FBgn0014863 Length:495 Species:Drosophila melanogaster


Alignment Length:180 Identity:87/180 - (48%)
Similarity:106/180 - (58%) Gaps:9/180 - (5%)


- Green bases have known domain annotations that are detailed below.


Human     9 KCGACEKTVYHAEEIQCNGRSFHKTCFHCMACRKALDSTTVAAHESEIYCKVCYGRRYGPKGIGY 73
            ||..|.|:||.|||....|..|||.||.|..|.|:||||....||.|:|||.|:||::||||.|:
  Fly    11 KCPRCGKSVYAAEERLAGGYVFHKNCFKCGMCNKSLDSTNCTEHERELYCKTCHGRKFGPKGYGF 75

Human    74 GQGAGCLSTDTGEHLGLQFQQSPKPARSVTTS---NPSKFTAKFGESEKCPRCGKSVYAAEKVMG 135
            |.|||.||.|.|.    ||.:......||...   .| :..|:..|.|.|||||..|||||:::.
  Fly    76 GTGAGTLSMDNGS----QFLRENGDVPSVRNGARLEP-RAIARAPEGEGCPRCGGYVYAAEQMLA 135

Human   136 GGKPWHKTCFRCAICGKSLESTNVTD-KDGELYCKVCYAKNFGPTGIGFG 184
            .|:.|||.||:|..|.|.|:|....: .|..:|||.||||.|||.|.|:|
  Fly   136 RGRSWHKECFKCGTCKKGLDSILCCEAPDKNIYCKGCYAKKFGPKGYGYG 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CSRP3NP_003467.1 Interaction with TCAP. /evidence=ECO:0000269|PubMed:12507422 1..5
LIM1_CRP3 9..62 CDD:188865 28/52 (54%)
Nuclear localization signal. /evidence=ECO:0000250|UniProtKB:P50463, ECO:0000255 64..69 2/4 (50%)
Interaction with CLF2 and isoform 2. /evidence=ECO:0000269|PubMed:19752190, ECO:0000269|PubMed:24860983 94..105 2/10 (20%)
LIM2_CRP3 120..173 CDD:188866 26/53 (49%)
Mlp84BNP_001303418.1 LIM1_MLP84B_like 11..64 CDD:188788 28/52 (54%)
LIM_CRP_like 120..173 CDD:188712 25/52 (48%)
LIM_CRP_like 222..275 CDD:188712
LIM_CRP_like 325..378 CDD:188712
LIM_CRP_like 421..474 CDD:188712
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142495
Domainoid 1 1.000 86 1.000 Domainoid score I8089
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4130
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1214165at2759
OrthoFinder 1 1.000 - - FOG0000284
OrthoInspector 1 1.000 - - otm40707
orthoMCL 1 0.900 - - OOG6_104400
Panther 1 1.100 - - LDO PTHR24215
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4662
SonicParanoid 1 1.000 - - X318
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.790

Return to query results.
Submit another query.