| Sequence 1: | NP_003467.1 | Gene: | CSRP3 / 8048 | HGNCID: | 2472 | Length: | 194 | Species: | Homo sapiens |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_730192.2 | Gene: | Lasp / 39864 | FlyBaseID: | FBgn0063485 | Length: | 657 | Species: | Drosophila melanogaster |
| Alignment Length: | 50 | Identity: | 19/50 - (38%) |
|---|---|---|---|
| Similarity: | 28/50 - (56%) | Gaps: | 0/50 - (0%) |
- Green bases have known domain annotations that are detailed below.
|
Human 10 CGACEKTVYHAEEIQCNGRSFHKTCFHCMACRKALDSTTVAAHESEIYCK 59 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CSRP3 | NP_003467.1 | Interaction with TCAP. /evidence=ECO:0000269|PubMed:12507422 | 1..5 | ||
| LIM1_CRP3 | 9..62 | CDD:188865 | 19/49 (39%) | ||
| Nuclear localization signal. /evidence=ECO:0000250|UniProtKB:P50463, ECO:0000255 | 64..69 | ||||
| Interaction with CLF2 and isoform 2. /evidence=ECO:0000269|PubMed:19752190, ECO:0000269|PubMed:24860983 | 94..105 | ||||
| LIM2_CRP3 | 120..173 | CDD:188866 | |||
| Lasp | NP_730192.2 | LIM_LASP | 5..57 | CDD:188831 | 19/49 (39%) |
| Nebulin | 67..94 | CDD:459977 | |||
| NEBU | 97..127 | CDD:128523 | |||
| SH3_Nebulin_family_C | 600..654 | CDD:212723 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||