DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CD276 and dpr21

DIOPT Version :9

Sequence 1:NP_001019907.1 Gene:CD276 / 80381 HGNCID:19137 Length:534 Species:Homo sapiens
Sequence 2:NP_001163838.2 Gene:dpr21 / 8674044 FlyBaseID:FBgn0260995 Length:282 Species:Drosophila melanogaster


Alignment Length:312 Identity:64/312 - (20%)
Similarity:106/312 - (33%) Gaps:91/312 - (29%)


- Green bases have known domain annotations that are detailed below.


Human   221 LVRNPVLQQDAHSSVTITP---------------QRSP---TGAVEVQVPEDPVVALVGTDATLR 267
            |:......|....:||:|.               .|.|   |.|.:      .|.:|||....|.
  Fly    14 LILKETCPQHFRENVTVTDLYLISENIVPMKRVLDRGPYFDTSATK------NVTSLVGITGHLN 72

Human   268 CSFSPEPGFSLAQLNLIW-------QLTDTKQLVHSFTEGRDQGSAYANRTALFPDLLAQGNASL 325
            |...     :|....:.|       .||.::.   ::|..:...|.|..:|         |:.||
  Fly    73 CRIK-----NLGNKTVSWIRHRDLHLLTVSES---TYTSDQRFTSIYNKQT---------GDWSL 120

Human   326 RLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITC-SSYRGY 389
            :::..::.|.|.:.|.||........:...|..|.:  |:...|...:..|.||.:|| ..:...
  Fly   121 QIKFPQLRDSGIYECQVSTTPPVGYTMVFSVVEPIT--SILGGPEIYIDLGSTVNLTCVIKHLPD 183

Human   390 PEAEVFWQDGQ----------GVPL---TGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVR 441
            |...|.|....          ||.:   .|::|||.:.          :.|..:..:|.|:||..
  Fly   184 PPISVQWNHNNQEINYDSPRGGVSVITEKGDITTSYLL----------IQRASIADSGQYTCLPS 238

Human   442 NP--------VLQQDAHGSVTITGQPMTFPPEALWVTVGLSVCLIALLVALA 485
            |.        :|:.|         .|.......|.|:..||:|.:.:.:.|:
  Fly   239 NANSKSVNVHILKGD---------HPAAVQKSHLLVSELLSLCFLQICLNLS 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CD276NP_001019907.1 IG_like 37..138 CDD:214653
Ig 43..139 CDD:299845
Ig 148..231 CDD:299845 2/9 (22%)
IG_like 156..237 CDD:214653 3/15 (20%)
IG_like 255..356 CDD:214653 22/107 (21%)
Ig 261..357 CDD:299845 19/102 (19%)
Ig 366..449 CDD:299845 22/104 (21%)
IG_like 374..456 CDD:214653 22/103 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 498..534
dpr21NP_001163838.2 Ig 71..149 CDD:299845 18/94 (19%)
IG_like 71..140 CDD:214653 18/85 (21%)
IG_like 162..249 CDD:214653 21/96 (22%)
IGc2 169..242 CDD:197706 20/82 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.