DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CD276 and dpr6

DIOPT Version :9

Sequence 1:NP_001019907.1 Gene:CD276 / 80381 HGNCID:19137 Length:534 Species:Homo sapiens
Sequence 2:NP_001287018.1 Gene:dpr6 / 50296 FlyBaseID:FBgn0040823 Length:396 Species:Drosophila melanogaster


Alignment Length:335 Identity:79/335 - (23%)
Similarity:127/335 - (37%) Gaps:105/335 - (31%)


- Green bases have known domain annotations that are detailed below.


Human   207 ILRVVLGANGTYSCLVRNPVLQQDAHSS----VTITP---------QRSPTGA----------VE 248
            :|.||:..:...:..|:.|:   :.::|    :|.||         ..:||.|          .:
  Fly    15 LLLVVIVMSDMTNGGVQGPI---EGYNSLDDLLTTTPTPGQAALLLPTAPTAAYTHPKWMEPYFD 76

Human   249 VQVPEDPVVALVGTDATLRCSFSPEPGFSLAQLNLIW-QLTDTKQL-VHSFTEGRDQ--GSAYAN 309
            ...|.: |.||:|..|.|.|...     :||...:.| :..|...| |.|:|...||  .:.:..
  Fly    77 PSTPRN-VTALMGKSAYLSCRVR-----NLANKTVSWIRHRDIHILTVGSYTYTSDQRFQATHHQ 135

Human   310 RTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLR 374
            .|.         :.:|:::..:..|.|.:.|.:|.:...|..|.|.|..    |:.|:....||.
  Fly   136 DTE---------DWTLQIKWAQKRDAGMYECQISTQPVRSYFVRLNVVV----PTATILGGPDLH 187

Human   375 --PGDTVTITCS-SYRGYPEAEVFWQDGQ----------GVPL---TGNVTTSQMANEQGLFDVH 423
              .|.|:.:||: .:...|.|.:||...:          ||.:   .|:||||.:.         
  Fly   188 VDKGSTINLTCTVKFSPEPPAYIFWYHHEEVINYDSSRGGVSVITEKGDVTTSFLL--------- 243

Human   424 SVLRVVLGANGTYSCL--------VRNPVLQQDAHGSVTITGQPMTFPPEAL----------WVT 470
             :....|..:|.|||.        ||..||...|    .|:|:    .|||:          |:|
  Fly   244 -IQNADLADSGKYSCAPSNADVASVRVHVLNVRA----IISGE----HPEAMQTGSSGCQYNWLT 299

Human   471 V----GLSVC 476
            :    ||.:|
  Fly   300 IVLLLGLVLC 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CD276NP_001019907.1 IG_like 37..138 CDD:214653
Ig 43..139 CDD:299845
Ig 148..231 CDD:299845 5/23 (22%)
IG_like 156..237 CDD:214653 6/33 (18%)
IG_like 255..356 CDD:214653 26/104 (25%)
Ig 261..357 CDD:299845 23/99 (23%)
Ig 366..449 CDD:299845 27/106 (25%)
IG_like 374..456 CDD:214653 25/105 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 498..534
dpr6NP_001287018.1 V-set 79..174 CDD:284989 27/109 (25%)
IG_like 80..175 CDD:214653 28/109 (26%)
IG_like 184..271 CDD:214653 24/96 (25%)
IGc2 191..262 CDD:197706 20/80 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.