DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CD276 and side

DIOPT Version :9

Sequence 1:NP_001019907.1 Gene:CD276 / 80381 HGNCID:19137 Length:534 Species:Homo sapiens
Sequence 2:NP_001247334.1 Gene:side / 43300 FlyBaseID:FBgn0016061 Length:986 Species:Drosophila melanogaster


Alignment Length:506 Identity:107/506 - (21%)
Similarity:179/506 - (35%) Gaps:127/506 - (25%)


- Green bases have known domain annotations that are detailed below.


Human    33 VPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFP 97
            :|...|.|.:|....|.|..:|.......:| |:| ..||..:.....:.:......|...|:..
  Fly    95 IPARLVWAALGKTVELPCDLTPPTSQDSVKL-LLW-FKDTTGIPLYSLDSRGGNVKLAPHAAIAS 157

Human    98 DL-----LAQG----NASLRLQRVRVADEGSFTCFVSIRDFGSAAV-----SLQVAAPYSKPSMT 148
            ||     .:.|    ::.|::..|:..|.|.:.|.|   ||.::..     :|.:..|..:|.:.
  Fly   158 DLGQRLFFSIGDNPKDSRLQINDVKPEDGGVYRCRV---DFFNSPTRNFRHNLTLVVPPEEPRIF 219

Human   149 LEPNKDL-------RPGDTVTITCSSYQGYPEAEV-FWQDGQGVPLTGNVTTSQMANEQGLF--- 202
            ....|::       |.|..:.:.|....|.|..:| :|:|.     |..:.||..:.|:|..   
  Fly   220 DAQGKEISQMAGPFREGYELFLCCQVRGGRPPPKVTWWRDD-----TELIGTSHTSVEEGATVMV 279

Human   203 ----------DVHSILRVVLGANGTYSCLVRNPVLQQDAHSSVTITPQRSPTGAVEVQVPEDPVV 257
                      |.:.| |:...|.||.  || :|| ::|....|.:.|.|     |::..|.:.:.
  Fly   280 NQLLIGTTTRDFYGI-RIECRAQGTR--LV-DPV-RKDVTVQVYLKPVR-----VKIATPNELLT 334

Human   258 ALVGTDATLRCSFSPEPGFSLAQLNLIWQL-----TDTKQLVHSFTEGRDQGSAYANRTALFPDL 317
            |  |....:||    |...|.....:.|.|     .:.:..|||..|                  
  Fly   335 A--GQPMPIRC----ESWGSYPAAKITWLLDGEPIRNAEVTVHSDKE------------------ 375

Human   318 LAQGNASLRLQRVRVA---DEGSFTCFVSIRDFGSAAVS----LQVAAPYSKPSMTLE-PNKD-- 372
              .||.:..:..::|.   |....||..:...|...|:.    ::||.|   |::::. .|:|  
  Fly   376 --DGNITTSILTLKVTSENDNAELTCRATNPWFSGGAIEDKRIIRVAYP---PTVSVHLANEDPS 435

Human   373 ----LRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVT----TSQMANEQGLFDVHSVLRVV 429
                ...|..||..|.:....|.....|.. .|:.::|..|    .:|:..|..           
  Fly   436 RLVTRAEGQNVTFKCRADARPPVTSYSWFK-NGMRMSGESTEIMHLTQLERESA----------- 488

Human   430 LGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFPPEALWVTVGLSVCLIAL 480
                |.|:|...| ...:....|:|:..|   |.|.....|...|:..::|
  Fly   489 ----GAYACGATN-TEGETRSSSLTLKVQ---FSPRCKSGTEQTSIGAVSL 531

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CD276NP_001019907.1 IG_like 37..138 CDD:214653 25/114 (22%)
Ig 43..139 CDD:299845 23/109 (21%)
Ig 148..231 CDD:299845 24/103 (23%)
IG_like 156..237 CDD:214653 25/94 (27%)
IG_like 255..356 CDD:214653 20/112 (18%)
Ig 261..357 CDD:299845 19/107 (18%)
Ig 366..449 CDD:299845 17/93 (18%)
IG_like 374..456 CDD:214653 17/85 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 498..534
sideNP_001247334.1 V-set 95..211 CDD:284989 26/120 (22%)
IG_like 100..211 CDD:214653 25/115 (22%)
Ig 235..301 CDD:299845 15/71 (21%)
Ig 326..408 CDD:299845 20/107 (19%)
IG_like 329..407 CDD:214653 19/103 (18%)
IG_like 435..511 CDD:214653 17/92 (18%)
Ig_2 442..511 CDD:290606 17/85 (20%)
FN3 <700..735 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.