DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CD276 and nrm

DIOPT Version :9

Sequence 1:NP_001019907.1 Gene:CD276 / 80381 HGNCID:19137 Length:534 Species:Homo sapiens
Sequence 2:NP_001246890.1 Gene:nrm / 40515 FlyBaseID:FBgn0262509 Length:2192 Species:Drosophila melanogaster


Alignment Length:522 Identity:97/522 - (18%)
Similarity:170/522 - (32%) Gaps:169/522 - (32%)


- Green bases have known domain annotations that are detailed below.


Human    37 PVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLA 101
            |:||:.....|..||.. :|||..:. ...|                                |.
  Fly   589 PLVAVKKKSVTFSCSVD-DPGFPESN-RFRW--------------------------------LR 619

Human   102 QGNASLR--------LQRVRVADEGSFTCFVSIRDFGS---AAVSLQVAAP-------------- 141
            .|...|:        ::.|.:....:::|: :..:.|.   |.|:|:|.||              
  Fly   620 GGRGPLQDIVTKDWTVEPVGLDSRTNYSCY-AYNEGGKGVMATVNLEVHAPPFFIKNLPPYTGIL 683

Human   142 YSKPSMTLEPNKDLRPGDTVTITCSSYQGYPEAEVFWQDGQGVPLTGN-----VTTSQMANEQGL 201
            :|.|:.||          |..|.|     .|..::.||. .|||:..|     :....|......
  Fly   684 HSSPNATL----------TCRIEC-----VPRCDISWQK-DGVPIERNDSRYFIKEKYMDASPAT 732

Human   202 FDVHSILRV--------------VLGANGTYSCLVRNPV----LQQDAHSSVTITPQRSPTGAVE 248
            .|..|:|.|              :...|..|||:....:    ::...:..:...|:.:......
  Fly   733 GDFESMLSVLHFNMPNWPDSKFNIEADNANYSCVSTGNIVGGSIRSRTYFGIEYAPENTTVSENI 797

Human   249 VQVPEDPVVALVGTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYANRTAL 313
            |.|.||.:...|    ..:...:|||.:.       |                    .:.|.|  
  Fly   798 VYVQEDTIPGRV----ICKSRANPEPSYK-------W--------------------IFKNET-- 829

Human   314 FPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDT 378
                :|.|||.:....:...|:|::|| ::....||:.....:...: ||...:|..:   ..|.
  Fly   830 ----IANGNALIINTAMNRNDDGTYTC-LAYNKHGSSIAKTVIKVQF-KPRCEIERQE---IDDQ 885

Human   379 VTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMAN---EQGLFDVHSVLRVVLGANGTYSCLV 440
            .|:.|::|....||:..|.     ..|.|.|...:.:   |..:.....:|:.....:.||.|:.
  Fly   886 DTLICTAYGNPIEADFSWS-----IKTENETDENLGSGKKENSVEKSFYILQTDYAISRTYRCVA 945

Human   441 RNPVLQQDAHG---SVTITGQPMTFPPEALW----------VTVGLSVCLIALLVALAFVCWRKI 492
            .|.|    .:|   .:.:..|...:   .||          ..:||.:.:|.:...:..:|.|:.
  Fly   946 NNTV----GYGPFCEIEVAEQLAWW---QLWEKNTLIILVAAILGLLLTVIVICCIIICICRRRR 1003

Human   493 KQ 494
            :|
  Fly  1004 RQ 1005

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CD276NP_001019907.1 IG_like 37..138 CDD:214653 19/111 (17%)
Ig 43..139 CDD:299845 16/106 (15%)
Ig 148..231 CDD:299845 21/105 (20%)
IG_like 156..237 CDD:214653 19/103 (18%)
IG_like 255..356 CDD:214653 17/100 (17%)
Ig 261..357 CDD:299845 16/95 (17%)
Ig 366..449 CDD:299845 18/85 (21%)
IG_like 374..456 CDD:214653 18/87 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 498..534
nrmNP_001246890.1 Ig 44..152 CDD:299845
Ig 176..248 CDD:299845
Ig 277..354 CDD:299845
IG_like 383..463 CDD:214653
Ig 394..463 CDD:143165
Ig_3 585..652 CDD:290638 15/97 (15%)
Ig 685..>719 CDD:299845 14/49 (29%)
IG_like 788..869 CDD:214653 22/118 (19%)
Ig <811..869 CDD:299845 16/91 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.