DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CD276 and igcm-2

DIOPT Version :9

Sequence 1:NP_001019907.1 Gene:CD276 / 80381 HGNCID:19137 Length:534 Species:Homo sapiens
Sequence 2:NP_001362087.1 Gene:igcm-2 / 180913 WormBaseID:WBGene00020130 Length:802 Species:Caenorhabditis elegans


Alignment Length:492 Identity:100/492 - (20%)
Similarity:170/492 - (34%) Gaps:125/492 - (25%)


- Green bases have known domain annotations that are detailed below.


Human    43 GTDATLCCSFS--PEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQ-GN 104
            |...||.||.|  .|..|||.     |: .|.:.::.:|  ||:||..    |......||: |.
 Worm    28 GAPITLPCSISLFNEESFSLD-----WR-KDGQLILSAF--GQEQGHV----TPTLQGRLARDGF 80

Human   105 ASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAP---------YSKPSMTLEPNKDL----R 156
            ..:.:..|...|.|.:.|.|:       ..|.|...|         .:.|.:.:.|:|:.    :
 Worm    81 LGITIHSVTDGDAGVYQCIVT
-------KFSKQPTRPEKGLSAKLVVNVPPVIISPSKNAIIHKK 138

Human   157 PGDTVTITCSSYQGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSILRVVLGANGTYSCL 221
            .|..:...|.: :|.|..|:.|...:.:..|..|.|.....|              |..|.|:||
 Worm   139 VGADLIFECKA-EGAPSPEITWSRNEQIISTSPVLTLSNLEE--------------GDKGLYTCL 188

Human   222 VRNPVLQQDAHSSVTITPQRSPTGAVEVQVPEDPVVALVGTDATLRCSFSPEPGFSLAQLNLIWQ 286
                          .:..:.:.|.:::|:..:..::.|:..:.|:           :...|:.| 
 Worm   189 --------------AVNIEGNSTSSI
DVRFTKATILDLIPLNKTV-----------IEGSNVFW- 227

Human   287 LTDTKQLVHSFTEGRDQGSAYA----NRTALFPDLLAQGN---ASLRLQRVRVADEGSFTCFV-- 342
                    |.....:....:|:    .:......|..:.|   ..|.||.||.:|.|.:||..  
 Worm   228 --------HCHANAQATAISYSWLFEKKPIKTTSLGLRSNIRSGDLSLQDVRKSDSGWYTCEAKN 284

Human   343 SIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGN 407
            |..:..|:...|.|..| .:|..:.:|.:.:..|...|::|............|..      .|:
 Worm   285 SAGETTSSTAYLHV
FYP-PEPLSSHQPVQTVASGRNTTVSCDVIANPTPTSYTWSK------NGH 342

Human   408 VTTSQMANEQGLFDVHSVLRVVL-GANGTYSCLVRNPVLQQDAHGSVT----ITGQPMTF---PP 464
            ...:|.::       |.::.... |..|.|.|...|..    ..||:.    |..:|..|   ||
 Worm   343 YLPTQASS-------HIIISYAKPGDGGIYGCQADNIA----GKGSIVETHLIVAEPPVFTVAPP 396

Human   465 EALWVTVG--LSVCLIALLVALAFVCW----RKIKQS 495
            ..:.|.:|  :|:........:..|.|    ::|.||
 Worm   397 SEIKVRLGDQVSIPCQGFGDPMPIVYWIRDKKRINQS 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CD276NP_001019907.1 IG_like 37..138 CDD:214653 27/97 (28%)
Ig 43..139 CDD:299845 28/98 (29%)
Ig 148..231 CDD:299845 17/86 (20%)
IG_like 156..237 CDD:214653 15/80 (19%)
IG_like 255..356 CDD:214653 20/109 (18%)
Ig 261..357 CDD:299845 19/104 (18%)
Ig 366..449 CDD:299845 13/83 (16%)
IG_like 374..456 CDD:214653 14/86 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 498..534
igcm-2NP_001362087.1 IG_like 23..101 CDD:214653 25/84 (30%)
Ig 124..200 CDD:386229 18/104 (17%)
IG_like 214..298 CDD:214653 19/103 (18%)
Ig_3 309..371 CDD:372822 12/74 (16%)
Ig 389..467 CDD:386229 11/45 (24%)
FN3 476..548 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.