DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CD276 and Cd276

DIOPT Version :9

Sequence 1:NP_001019907.1 Gene:CD276 / 80381 HGNCID:19137 Length:534 Species:Homo sapiens
Sequence 2:NP_598744.1 Gene:Cd276 / 102657 MGIID:2183926 Length:316 Species:Mus musculus


Alignment Length:291 Identity:270/291 - (92%)
Similarity:283/291 - (97%) Gaps:0/291 - (0%)


- Green bases have known domain annotations that are detailed below.


Human   244 TGAVEVQVPEDPVVALVGTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYA 308
            ||||||||.||||||||.||||||||||||||||||||||||||||||||||||||||||||||:
Mouse    26 TGAVEVQVSEDPVVALVDTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYS 90

Human   309 NRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDL 373
            ||||||||||.|||||||||||||.||||:||||||:||.|||||||||||||||||||||||||
Mouse    91 NRTALFPDLLVQGNASLRLQRVRVTDEGSYTCFVSIQDFDSAAVSLQVAAPYSKPSMTLEPNKDL 155

Human   374 RPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSC 438
            |||:.||||||||:|||||||||:|||||||||||||||||||:|||||||||||||||||||||
Mouse   156 RPGNMVTITCSSYQGYPEAEVFWKDGQGVPLTGNVTTSQMANERGLFDVHSVLRVVLGANGTYSC 220

Human   439 LVRNPVLQQDAHGSVTITGQPMTFPPEALWVTVGLSVCLIALLVALAFVCWRKIKQSCEEENAGA 503
            |||||||||||||||||||||:|||||||||||||||||:.||||||||||||||||||||||||
Mouse   221 LVRNPVLQQDAHGSVTITGQPLTFPPEALWVTVGLSVCLVVLLVALAFVCWRKIKQSCEEENAGA 285

Human   504 EDQDGEGEGSKTALQPLKHSDSKEDDGQEIA 534
            |||||:||||||||:|||.|::|||||||||
Mouse   286 EDQDGDGEGSKTALRPLKPSENKEDDGQEIA 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CD276NP_001019907.1 IG_like 37..138 CDD:214653
Ig 43..139 CDD:299845
Ig 148..231 CDD:299845
IG_like 156..237 CDD:214653
IG_like 255..356 CDD:214653 93/100 (93%)
Ig 261..357 CDD:299845 88/95 (93%)
Ig 366..449 CDD:299845 77/82 (94%)
IG_like 374..456 CDD:214653 76/81 (94%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 498..534 30/35 (86%)
Cd276NP_598744.1 IG_like 37..138 CDD:214653 93/100 (93%)
Ig 44..139 CDD:299845 88/94 (94%)
IgC 149..235 CDD:143166 80/85 (94%)
IG_like 156..238 CDD:214653 76/81 (94%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 280..316 30/35 (86%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C83954048
Domainoid 1 1.000 178 1.000 Domainoid score I28811
eggNOG 1 0.900 - - E1_2CFG9
HGNC 1 1.500 - -
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H11892
Inparanoid 1 1.050 549 1.000 Inparanoid score I11378
Isobase 00.000 Not matched by this tool.
NCBI 1 1.000 - -
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0010893
OrthoInspector 1 1.000 - - oto124359
orthoMCL 1 0.900 - - OOG6_116081
Panther 1 1.100 - - LDO PTHR24100
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X8433
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1515.290

Return to query results.
Submit another query.