DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CD276 and Cd276

DIOPT Version :10

Sequence 1:NP_001019907.1 Gene:CD276 / 80381 HGNCID:19137 Length:534 Species:Homo sapiens
Sequence 2:NP_001411606.1 Gene:Cd276 / 102657 MGIID:2183926 Length:334 Species:Mus musculus


Alignment Length:309 Identity:270/309 - (87%)
Similarity:283/309 - (91%) Gaps:18/309 - (5%)


- Green bases have known domain annotations that are detailed below.


Human   244 TGAVEVQVPEDPVVALVGTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYA 308
            ||||||||.||||||||.||||||||||||||||||||||||||||||||||||||||||||||:
Mouse    26 TGAVEVQVSEDPVVALVDTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYS 90

Human   309 NRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQV----------------- 356
            ||||||||||.|||||||||||||.||||:||||||:||.||||||||                 
Mouse    91 NRTALFPDLLVQGNASLRLQRVRVTDEGSYTCFVSIQDFDSAAVSLQVADSKAVETSWKDGAASG 155

Human   357 -AAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLF 420
             ||||||||||||||||||||:.||||||||:|||||||||:|||||||||||||||||||:|||
Mouse   156 SAAPYSKPSMTLEPNKDLRPGNMVTITCSSYQGYPEAEVFWKDGQGVPLTGNVTTSQMANERGLF 220

Human   421 DVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFPPEALWVTVGLSVCLIALLVALA 485
            |||||||||||||||||||||||||||||||||||||||:|||||||||||||||||:.||||||
Mouse   221 DVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPLTFPPEALWVTVGLSVCLVVLLVALA 285

Human   486 FVCWRKIKQSCEEENAGAEDQDGEGEGSKTALQPLKHSDSKEDDGQEIA 534
            |||||||||||||||||||||||:||||||||:|||.|::|||||||||
Mouse   286 FVCWRKIKQSCEEENAGAEDQDGDGEGSKTALRPLKPSENKEDDGQEIA 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CD276NP_001019907.1 IgV_B7-H3 32..142 CDD:409528
FR1 32..51 CDD:409528
Ig strand A 32..35 CDD:409528
Ig strand A' 37..41 CDD:409528
Ig strand B 44..51 CDD:409528
CDR1 52..60 CDD:409528
FR2 62..72 CDD:409528
Ig strand C 62..69 CDD:409528
CDR2 74..86 CDD:409528
Ig strand C' 75..80 CDD:409528
FR3 89..127 CDD:409528
Ig strand D 92..98 CDD:409528
Ig strand E 104..110 CDD:409528
Ig strand F 119..127 CDD:409528
CDR3 128..130 CDD:409528
Ig strand G 130..139 CDD:409528
FR4 131..142 CDD:409528
Ig_3 144..224 CDD:464046
IgV_B7-H3 250..360 CDD:409528 101/127 (80%)
FR1 250..269 CDD:409528 16/18 (89%)
Ig strand A 250..253 CDD:409528 2/2 (100%)
Ig strand A' 255..259 CDD:409528 3/3 (100%)
Ig strand B 262..269 CDD:409528 6/6 (100%)
CDR1 270..278 CDD:409528 7/7 (100%)
FR2 280..290 CDD:409528 9/9 (100%)
Ig strand C 280..287 CDD:409528 6/6 (100%)
CDR2 292..304 CDD:409528 11/11 (100%)
Ig strand C' 293..298 CDD:409528 4/4 (100%)
Ig strand C' 301..304 CDD:409528 2/2 (100%)
FR3 307..345 CDD:409528 33/37 (89%)
Ig strand D 310..316 CDD:409528 5/5 (100%)
Ig strand E 322..328 CDD:409528 5/5 (100%)
Ig strand F 337..345 CDD:409528 6/7 (86%)
CDR3 346..348 CDD:409528 1/1 (100%)
Ig strand G 348..357 CDD:409528 8/26 (31%)
FR4 349..360 CDD:409528 10/28 (36%)
Ig_3 362..442 CDD:464046 74/79 (94%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 498..534 30/35 (86%)
Cd276NP_001411606.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.