DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DNAJC5 and Droj2

DIOPT Version :10

Sequence 1:NP_079495.1 Gene:DNAJC5 / 80331 HGNCID:16235 Length:198 Species:Homo sapiens
Sequence 2:NP_650283.1 Gene:Droj2 / 41646 FlyBaseID:FBgn0038145 Length:403 Species:Drosophila melanogaster


Alignment Length:68 Identity:37/68 - (54%)
Similarity:50/68 - (73%) Gaps:3/68 - (4%)


- Green bases have known domain annotations that are detailed below.


Human    17 YHVLGLDKNATSDDIKKSYRKLALKYHPDKNPDNPEAADKFKEINNAHAILTDATKRNIYDKYGS 81
            |.:||:..|||.|::||:||||||||||||||:..|   |||.|:.|:.:|:||.||.:||:.|.
  Fly     8 YDILGVKPNATPDELKKAYRKLALKYHPDKNPNEGE---KFKAISQAYEVLSDADKRQVYDEGGE 69

Human    82 LGL 84
            ..:
  Fly    70 AAI 72

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DNAJC5NP_079495.1 PRK10767 17..>80 CDD:236757 36/62 (58%)
Droj2NP_650283.1 PTZ00037 2..398 CDD:240236 37/68 (54%)

Return to query results.
Submit another query.