DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DNAJC5 and DnaJ-60

DIOPT Version :10

Sequence 1:NP_079495.1 Gene:DNAJC5 / 80331 HGNCID:16235 Length:198 Species:Homo sapiens
Sequence 2:NP_523840.1 Gene:DnaJ-60 / 37869 FlyBaseID:FBgn0260775 Length:217 Species:Drosophila melanogaster


Alignment Length:144 Identity:30/144 - (20%)
Similarity:50/144 - (34%) Gaps:55/144 - (38%)


- Green bases have known domain annotations that are detailed below.


Human    14 ESLYHVLGLDKNATSDDIKKSYRKLALKYHPD--KNPDNPEAADKFKEINNAHAILTDATKRNIY 76
            |:.|.||.:..:.::.:::.::.:|:..||||  .|...||...:|.:|:.|:..|....:|..|
  Fly    25 ETHYEVLNIRNDCSTREVRNAFVQLSKLYHPDVKSNAACPERTARFVQISEAYKTLIKPERRRDY 89

Human    77 DK-------------------------------------YGSLGL----------------YVAE 88
            |.                                     ||..||                :|..
  Fly    90 DDSLLWQPSRSDRSPVGETVNPGQAWDVRPNYDPNPGPYYGIRGLKRVSNWQVAVVLMALGFVGA 154

Human    89 QFGEENVNTYFVLS 102
            .||..:|.:.|.||
  Fly   155 LFGFTSVRSSFKLS 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DNAJC5NP_079495.1 PRK10767 17..>80 CDD:236757 18/101 (18%)
DnaJ-60NP_523840.1 DnaJ 26..90 CDD:395170 16/63 (25%)

Return to query results.
Submit another query.