DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DNAJC5 and DnaJ-H

DIOPT Version :10

Sequence 1:NP_079495.1 Gene:DNAJC5 / 80331 HGNCID:16235 Length:198 Species:Homo sapiens
Sequence 2:NP_001260431.1 Gene:DnaJ-H / 34707 FlyBaseID:FBgn0032474 Length:440 Species:Drosophila melanogaster


Alignment Length:91 Identity:43/91 - (47%)
Similarity:62/91 - (68%) Gaps:6/91 - (6%)


- Green bases have known domain annotations that are detailed below.


Human    15 SLYHVLGLDKNATSDDIKKSYRKLALKYHPDKNPDNPEAADKFKEINNAHAILTDATKRNIYDKY 79
            :||.||.:..:||.::|||:|||||.::|||||||   |.||||||:.|:.:|:|..||.|||:|
  Fly     5 NLYDVLKVAPDATDEEIKKNYRKLAKEFHPDKNPD---AGDKFKEISFAYEVLSDPEKRRIYDRY 66

Human    80 GSLGLYVAEQFGEENVNTYFVLSSWW 105
            |..||....: |..:.:.:|  :.|:
  Fly    67 GLKGLQEGAE-GFSDASEFF--AQWF 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DNAJC5NP_079495.1 PRK10767 17..>80 CDD:236757 35/62 (56%)
DnaJ-HNP_001260431.1 PTZ00037 1..386 CDD:240236 43/91 (47%)

Return to query results.
Submit another query.