DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LRRC27 and lrch-1

DIOPT Version :9

Sequence 1:NP_001137229.1 Gene:LRRC27 / 80313 HGNCID:29346 Length:530 Species:Homo sapiens
Sequence 2:NP_509042.1 Gene:lrch-1 / 180893 WormBaseID:WBGene00015779 Length:638 Species:Caenorhabditis elegans


Alignment Length:544 Identity:113/544 - (20%)
Similarity:184/544 - (33%) Gaps:174/544 - (31%)


- Green bases have known domain annotations that are detailed below.


Human    50 LDLSESGLCRLEE-VFRIPSLQQLHLQRNALCVIPQDFFQLLPNLTWLD------------LRY- 100
            :|.|.:.:..|.: :|.:| |:.|.|..|.:..||:...:|.|.|..||            ||| 
 Worm   126 IDFSSNDISHLPDGLFDLP-LKALILANNKITCIPEGIRRLAPTLAHLDFSKNDIRSLQSQLRYL 189

Human   101 ----------NRIKALPSGIGAHQHLKTLLLERNPIKMLPVELGSVTTLKALNLRHCPLEFPPQL 155
                      ||::..|:.:.:...|:||.|..|.:..||.:...:|.|:.|.|...||..|...
 Worm   190 TSLEVLKISRNRVEDFPAELCSSLKLRTLDLSHNNLSYLPADFVKMTDLRYLQLECNPLRSPSMD 254

Human   156 VVQKGLVAIQRFL--RMWAVEHS--------LPRNPT--------SQEAPPVRE-MTLRDLPSPG 201
            :::.|:|.|.::|  |..|...:        |.|..|        :::.||..| ...|:.|.|.
 Worm   255 IIEMGIV
HIFKWLDGRTSACSTTSNGSNDVLLDRKRTTTASTTIVAEKHPPHNESRATRNPPEPV 319

Human   202 LELSGDHASNQG----------------AVNAQDPEGAVMKEKASFLP---PVEKPDLSELRKSA 247
            ..:..||....|                :|:|:.....:::.|.|.:|   |........||:|.
 Worm   320 KHVQHDHRPVNGNLNHRPKELVESRTITSVHAKSHNVQIVQNKISSVPSHLPTSNGGKENLRQST 384

Human   248 -DSSENWPSEEEIRRFWKLRQEIVEHVKADVLGDQLLTRELPPNLKAALNIEKELPKPRHVFRRK 311
             |...|..:........||..   ..:.:..:|.:.:::..|            :|||.   .|.
 Worm   385 PDEQNNNNNNNNDNEKSKLSS---SSLSSPGMGKKPISKVAP------------MPKPT---PRP 431

Human   312 TASSRSI---LPDLLSPYQMAIRAKRLEESRAAALRELQEKQALMEQQRREKRALQEWRERAQRM 373
            .|::.::   :..:..|..:.........:.|...:|:..|...:                |..:
 Worm   432 IATNGNVQTKIGTVRRPNPIQSTTVTRSTNTATVKKEIPVKTTKI----------------ASAI 480

Human   374 RKRKEELSKLLPPRRSMVASKIPSATDLIDNRKVPLNPPGKMKPSKEKSPQASKEMSALQERNLE 438
            .:|.||      |....:|||  ..|..:.|    ||..|...|:                    
 Worm   481 SRRSEE------PAAQKIASK--PITSSVTN----LNKSGLRAPA-------------------- 513

Human   439 EKIKQHVLQMREQRRFHGQAPLEEMRKAAEDLEIATELQDEVLKLKLGLT--LNKDRRRAALTGN 501
                                     ...|.|:|.|.:|..|    |||.|  |||        |:
 Worm   514 -------------------------TGIANDVESARKLMRE----KLGPTFSLNK--------GD 541

Human   502 LSLGLPAAQPQN--TFFNTKYGES 523
            :|..|..:..|.  .|.|..:.||
 Worm   542 ISFSLQLSDGQELCKFINKLHPES 565

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LRRC27NP_001137229.1 LRR 1 46..67 4/17 (24%)
leucine-rich repeat 49..68 CDD:275378 4/18 (22%)
LRR_8 67..126 CDD:290566 23/81 (28%)
LRR_4 67..108 CDD:289563 17/63 (27%)
LRR 2 68..89 6/20 (30%)
leucine-rich repeat 69..92 CDD:275378 7/22 (32%)
LRR_4 91..127 CDD:289563 15/58 (26%)
LRR 3 92..113 9/43 (21%)
leucine-rich repeat 93..115 CDD:275378 9/44 (20%)
LRR 4 115..136 7/20 (35%)
leucine-rich repeat 116..138 CDD:275378 7/21 (33%)
LRR 5 138..159 6/20 (30%)
leucine-rich repeat 139..150 CDD:275378 4/10 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 178..215 11/61 (18%)
DUF3629 <331..471 CDD:289102 19/139 (14%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 402..432 5/29 (17%)
lrch-1NP_509042.1 LRR <64..>261 CDD:227223 37/135 (27%)
leucine-rich repeat 75..102 CDD:275380
leucine-rich repeat 123..142 CDD:275380 3/15 (20%)
leucine-rich repeat 145..168 CDD:275380 7/22 (32%)
leucine-rich repeat 169..191 CDD:275380 6/21 (29%)
leucine-rich repeat 192..214 CDD:275380 3/21 (14%)
leucine-rich repeat 215..237 CDD:275380 7/21 (33%)
CH <544..623 CDD:381763 6/22 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.