DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SCUBE1 and Cubn

DIOPT Version :9

Sequence 1:NP_766638.2 Gene:SCUBE1 / 80274 HGNCID:13441 Length:988 Species:Homo sapiens
Sequence 2:NP_727348.2 Gene:Cubn / 326235 FlyBaseID:FBgn0052702 Length:3750 Species:Drosophila melanogaster


Alignment Length:1130 Identity:236/1130 - (20%)
Similarity:360/1130 - (31%) Gaps:359/1130 - (31%)


- Green bases have known domain annotations that are detailed below.


Human    27 GLPGSVDVDECS--EGTD-DCHIDAICQNTPKSYKCLCKPGYKG--------------------- 67
            |....:||:||:  |||| .|.....|||...:|.|||:||:.|                     
  Fly   186 GTKCEMDVNECALYEGTDLGCQNGGQCQNHFGTYSCLCQPGWHGMHCTQRKADCSQSSAWELCGH 250

Human    68 ---------EGKQC----------------EDIDECENDYYNGGCVHECINIPGNYRCT-CFDGF 106
                     .|.:|                ||:|||.:...:..|...|||:||::.|. |..| 
  Fly   251 GSCVPSADDAGYRCICEPGWKTNGLTPICGEDVDECSDSAAHKPCSTSCINLPGSFTCAPCPAG- 314

Human   107 MLAHDGHNCLDVDECQDNNGGC----QQICVNAMGSYEC-QCHSGFFLSDNQHTCIHRSNEGMNC 166
             |..:|.:|.|:||||.|||||    :..|:|..|||.| :|..|:            :.:|..|
  Fly   315 -LTGNGVSCRDLDECQTNNGGCSLSPKVDCINTYGSYHCGECPVGW------------TGDGRKC 366

Human   167 MNKDHGCAHICRETPKGGVACDCRPGFDLAQNQKDCTLTCNYGNGGCQHSCEDTDTGPTCGCHQK 231
            .......     :.|.|.....|..|.:.......|.|.....:..|......|..||. ||   
  Fly   367 ERSPQDI-----DIPAGQTPRTCPAGNNPCYPTASCFLISGTTSCRCPMGMVGTGYGPN-GC--- 422

Human   232 YALHSDGRTCIETCAVNNGGCDRTCKDTATGVRCSCPVGF---TLQPDGKTCKDINECLVNNGGC 293
              ::.....|.|...:|.|.|........|   |.||:||   ..:|....| |.:.|  .||| 
  Fly   423 --VNGTTTNCKENPCLNGGICLFAGPSNYT---CLCPIGFRPPICEPQPSPC-DQHPC--KNGG- 478

Human   294 DHFCRNTVGS--FECGCRKGYK-LLTDER--TCQDI--------------------DECSFE-RT 332
              .||.|...  |.|.|..||: .|.:.|  :|..:                    .:|::. ||
  Fly   479 --RCRPTTSGDLFVCQCLPGYRGRLCETRFSSCNGMLSAQSGRLRYPPEGTGYEHNAQCAWVIRT 541

Human   333 CDHICINSPGSFQCLCHRGYILYGTTHCGDVDECSMSNGSCDQG---CVNTKGSYECVCPPGRRL 394
            .:.:.:|             :.:.:....|..||.......:.|   .....|.|   |  |..|
  Fly   542 NESLVVN-------------VTFNSFDVEDSTECRFDWLQINDGRSAAAQIIGRY---C--GNHL 588

Human   395 HWNGKDCVETGKCLSRAKTSPRAQLSCSKAGGVESCFLSCPAHTLFVPDSENSYVLSCGVPGPQG 459
            . :|.:.|.:|   ::.....|:..|.:|.|               ...:.||....||     |
  Fly   589 P-HGGNIVSSG---NQLYLWFRSDNSTAKEG---------------FDLTWNSMEPQCG-----G 629

Human   460 KALQKRNGT-----SSGLGPSCSD------APTTPIKQKARFKIRDAKCHLRPHSQARAKETARQ 513
            :...:.:||     |.|..|...|      ||||     .|.|:......|..|:          
  Fly   630 RLNFETHGTLASPGSPGNYPKNRDCRWQLVAPTT-----KRIKLTFFSLQLEQHA---------- 679

Human   514 PLLDHCHVTFVTLKCDSSKKRR------RGRKSPSKEVSHIT-------AE-----FEIETKMEE 560
                :|:..:|.:| ||...|.      .|..:|....:|:.       ||     |::...:||
  Fly   680 ----NCNFDYVLIK-DSISGRELAKYCTTGAPAPLLLPTHLAEIHFHSDAEGSDTGFQLHYSVEE 739

Human   561 ASDTCEADCLRKRAEQSLQAAIKT----------LRKSIGRQQFYVQVSGTEYEVAQRPAKALE- 614
            ....|......|....|..:...|          :..::| :|..:|.:..|.:    |...|| 
  Fly   740 RVPGCGGVYTAKEGTISESSTANTEPGGVSCEYEIHLAVG-EQVVIQFARLELD----PLDCLEV 799

Human   615 ----GQGACGAGQVLQDSKCVA----CGPGTHFGGELGQC---VSCMPGTYQDMEGQLSCT-PCP 667
                .:|    |.:||:..|.:    ..|.| |..|..:.   .....|::| :..:::|. ...
  Fly   800 LDITDEG----GSILQEKICGSDASRLNPPT-FTSEFNRLKIKFYARAGSFQ-LNYRMACDYKLN 858

Human   668 SSDG-LGLPGARNVSECGGQCSPGFFSA-----------------------------------DG 696
            :..| :..||..|::.....|:....:|                                   ||
  Fly   859 NEQGTITSPGYPNLTRSDRICTYTISTATNTVISLKRIDFQLTNGESDDDDNDECLTTNLRINDG 923

Human   697 FKPCQACP-VGTYQPEPG------------RTGCFPCGGGLLTKHEGTTSFQDCEAKVHCSPGHH 748
            .......| .|..|||..            .|.....|.|...::....:..|....||...|.|
  Fly   924 LNRKILGPYCGKNQPEENFVSETNYLQLHLSTDVDSMGRGFKFEYRALATGNDKCGGVHTRSGDH 988

Human   749 YNTTTH--------RC---IRCP----VGTYQPEFGQNHCITC---------------------P 777
            .....|        .|   |..|    :..:...|...:.:.|                     |
  Fly   989 IRLPVHDDSYAGEATCYWVIMAPANKAIRLHWNSFSLENAVDCIYDYLEIYDSLGAQVNDERSKP 1053

Human   778 -----GNT-------------------STDFDGSTNVTHC--KNQHCGGELGDYTGYIESPNYPG 816
                 ||:                   .::.||..::|:.  ....|||.:...:|.:.||.||.
  Fly  1054 LAKYCGNSVPEDLLSHSRQLVLKFVSDYSESDGGFDLTYTFEDRAKCGGHIHASSGELTSPEYPA 1118

Human   817 DYPANAECVWHIAPPPKRRILIVVPEIFLPIEDEC-GDVLVMRKSASPTSITTYETCQTYERPIA 880
            :|.|..:|.||:.......:.|.|....|.....| .|.|.:|......|......|.. :.|..
  Fly  1119 NYSAGLDCDWHLTGTIDHLLEIQVENFELEQSPNCSADYLEVRNGGGTDSPLIGRFCGR-DIPAR 1182

Human   881 FTSRSRKLWIQFKSNEGNSGKGFQV 905
            ....|.::.:...::...:|:||::
  Fly  1183 IPGFSHEMRLILHTDSAINGRGFRL 1207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SCUBE1NP_766638.2 EGF_3 37..72 CDD:289699 17/67 (25%)
FXa_inhibition 84..115 CDD:291342 11/31 (35%)
FXa_inhibition 121..156 CDD:291342 15/39 (38%)
FXa_inhibition 166..202 CDD:291342 5/35 (14%)
FXa_inhibition 206..241 CDD:291342 6/34 (18%)
FXa_inhibition 245..280 CDD:291342 10/37 (27%)
FXa_inhibition 286..321 CDD:291342 14/39 (36%)
vWFA <318..354 CDD:294047 6/58 (10%)
FXa_inhibition 366..401 CDD:291342 8/37 (22%)
GCC2_GCC3 636..683 CDD:285001 10/51 (20%)
GCC2_GCC3 690..737 CDD:285001 11/94 (12%)
GCC2_GCC3 746..793 CDD:285001 14/106 (13%)
CUB 798..909 CDD:238001 27/109 (25%)
CubnNP_727348.2 EGF_CA 156..190 CDD:238011 1/3 (33%)
EGF_CA 192..233 CDD:238011 19/40 (48%)
EGF_CA 282..322 CDD:214542 15/41 (37%)
EGF_3 328..366 CDD:289699 16/49 (33%)
EGF 430..457 CDD:278437 9/29 (31%)
EGF_CA 469..503 CDD:238011 15/39 (38%)
CUB 509..622 CDD:238001 21/149 (14%)
CUB 627..737 CDD:238001 29/134 (22%)
CUB 744..849 CDD:294042 22/115 (19%)
CUB 853..970 CDD:238001 17/116 (15%)
CUB 978..1094 CDD:238001 16/115 (14%)
CUB 1100..1211 CDD:238001 27/109 (25%)
CUB 1216..1330 CDD:238001
CUB 1446..1549 CDD:238001
CUB 1554..1667 CDD:238001
CUB 1792..1899 CDD:238001
CUB 1910..1998 CDD:294042
CUB 2019..2133 CDD:238001
CUB 2140..2242 CDD:238001
CUB 2263..2379 CDD:238001
CUB 2385..2511 CDD:238001
CUB 2516..2630 CDD:238001
CUB <2833..2892 CDD:294042
CUB 2898..3008 CDD:238001
CUB 3011..3127 CDD:238001
CUB 3130..3241 CDD:238001
CUB 3254..3363 CDD:238001
CUB 3379..3508 CDD:238001
CUB 3531..3601 CDD:294042
CUB 3623..3733 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.