DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment STAM and Wdfy2

DIOPT Version :10

Sequence 1:NP_003464.1 Gene:STAM / 8027 HGNCID:11357 Length:540 Species:Homo sapiens
Sequence 2:NP_609400.1 Gene:Wdfy2 / 34425 FlyBaseID:FBgn0032246 Length:408 Species:Drosophila melanogaster


Alignment Length:68 Identity:15/68 - (22%)
Similarity:30/68 - (44%) Gaps:8/68 - (11%)


- Green bases have known domain annotations that are detailed below.


Human   452 PSQQTQAAYPNT-----MVSSVQGNTYPSQAPVYSPPPAATAAAA---TADVTLYQNAGPNMPQV 508
            |:|:|.....||     ::|.::|::....|.:..|......:.:   |..|.|.:::|...|.:
  Fly     7 PAQRTNNDRFNTSKKPELLSKLEGSSDDVNAAILIPGENGVISVSDDKTVRVWLKRDSGQYWPSI 71

Human   509 PNY 511
            ..|
  Fly    72 CQY 74

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
STAMNP_003464.1 VHS_STAM1 9..139 CDD:340797
SH3_STAM1 213..267 CDD:212897
GAT_STAM1 301..377 CDD:410594
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 500..540 3/12 (25%)
Wdfy2NP_609400.1 WD40 24..279 CDD:475233 10/51 (20%)
WD40 repeat 35..72 CDD:293791 7/36 (19%)
WD40 repeat 80..117 CDD:293791
WD40 repeat 125..161 CDD:293791
WD40 repeat 166..205 CDD:293791
WD40 repeat 211..248 CDD:293791
WD40 repeat 253..283 CDD:293791
FYVE_WDFY1_like 287..356 CDD:277258
WD40 repeat 324..371 CDD:293791
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.