DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RAB11FIP1 and fic1

DIOPT Version :9

Sequence 1:NP_001002814.2 Gene:RAB11FIP1 / 80223 HGNCID:30265 Length:1283 Species:Homo sapiens
Sequence 2:NP_595651.1 Gene:fic1 / 2541203 PomBaseID:SPBC83.18c Length:272 Species:Schizosaccharomyces pombe


Alignment Length:241 Identity:52/241 - (21%)
Similarity:90/241 - (37%) Gaps:52/241 - (21%)


- Green bases have known domain annotations that are detailed below.


Human    22 VTVLQARGLRAKGPGGTSDAYAVIQVGKEKYATSVSERSLGAPVWREEATFELPSLLSSGPAAAA 86
            |.:.:|:.|..|...|....|.|.:||:....|...:||...|.|.....|.:||      .:..
pombe    11 VRIWKAKNLPNKALVGKQSPYCVCRVGEVVKRTQTDKRSGQEPSWNAVLEFNIPS------ESYH 69

Human    87 TLQLTVLHRALLGLDKFLGRAEVDLRDLHRDQGRRKTQWYKLKSKPGKKDKERGEIEVDIQFMRN 151
            .:::||.|.........:|...:......:::  .:::||:||:    :.:..||:.|..:|:..
pombe    70 IMKITVFHEGFRKHPHLIGDTVLSFEKAMKEE--LQSEWYELKN----EFQFAGELSVQFKFIPT 128

Human   152 NMTASMFD-LSMKDKSRNPFGKLKDKIKGKNKDSGSDTASAIIPSTTPSVDSDDESVVKDKKKKS 215
            :  ...|| .|.|...:.|:..                    :.:.||        |.|...|.|
pombe   129 D--PLYFDRASSKPVLQFPYSS--------------------VAALTP--------VPKKPSKPS 163

Human   216 KIKTLLSKSNLQKTPLSQSMSVLPTSKPEKVLLRPGDFQSQWDEDD 261
            |.:        :|.|:|..:...|.|:.|.|.: |.:......|||
pombe   164 KPR--------KKVPVSHPLPPTPPSREEHVSV-PRESSLFTYEDD 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RAB11FIP1NP_001002814.2 C2_Rab11-FIP_classI 20..147 CDD:176064 28/124 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 161..281 21/101 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 330..727
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 741..782
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 835..913
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 969..993
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1037..1141
Necessary for interaction with RAB4A and RAB11A, subcellular location and endosomal recycling 1219..1283
RBD-FIP 1226..1273 CDD:255374
fic1NP_595651.1 C2_fungal_Inn1p-like 7..125 CDD:176063 28/125 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.