DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment si:dkey-28d5.14 and lectin-22C

DIOPT Version :9

Sequence 1:XP_021333342.1 Gene:si:dkey-28d5.14 / 799569 ZFINID:ZDB-GENE-060503-730 Length:367 Species:Danio rerio
Sequence 2:NP_001137766.1 Gene:lectin-22C / 7354375 FlyBaseID:FBgn0259230 Length:263 Species:Drosophila melanogaster


Alignment Length:118 Identity:32/118 - (27%)
Similarity:58/118 - (49%) Gaps:8/118 - (6%)


- Green bases have known domain annotations that are detailed below.


Zfish    19 ECVQRQYHFINE--EKEWAEAQRYCREKYTDLATVDNMNDMIQLNKSVNVNVNDGVWIGLQGTND 81
            |.:..:|::|.:  ||.|:.|.:.||.....||.:.:..|:..:  ..|:..:...|:|:...:.
  Fly   140 EQIGSKYYYIEKVSEKNWSTASKTCRNMGGHLADIKDEADLAAI--KANLKEDTHYWLGINDLDH 202

Zfish    82 SNWHWS--SGDPVFFVNWASGQPA--GSNNCTVMTNGKWFVGSCSNTWTFICK 130
            .....|  :|....|:.||||:|:  .:.||..:.||:.:...|..|:.|||:
  Fly   203 EGKFLSMPTGKQTTFLKWASGRPSQLDTLNCVFLYNGEMYDYPCHYTFRFICQ 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
si:dkey-28d5.14XP_021333342.1 CLECT 23..129 CDD:321932 29/111 (26%)
CLECT 135..246 CDD:321932
CLECT 252..364 CDD:153057
lectin-22CNP_001137766.1 CLECT 146..255 CDD:153057 30/110 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X29
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.