DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NANOG and Nanog

DIOPT Version :9

Sequence 1:NP_079141.2 Gene:NANOG / 79923 HGNCID:20857 Length:305 Species:Homo sapiens
Sequence 2:NP_001094251.1 Gene:Nanog / 414065 RGDID:1303178 Length:312 Species:Rattus norvegicus


Alignment Length:318 Identity:189/318 - (59%)
Similarity:227/318 - (71%) Gaps:22/318 - (6%)


- Green bases have known domain annotations that are detailed below.


Human     1 MSVDPACPQSLP-CFEASDCKESSPMPVICGPEENYPSLQMSSAEMPHTETVSPLPSSMDLLIQD 64
            ||||.:.|.||| |.|||:..:|||||.:..|||||..||:|:.||..|||.||.|||.||.:||
  Rat     1 MSVDLSGPHSLPSCEEASNSGDSSPMPAVHLPEENYSCLQVSATEMLCTETASPPPSSGDLPLQD 65

Human    65 SPDSSTSPKGK--QPTSAEKSVAKKEDKVPVKKQKTRTVFSSTQLCVLNDRFQRQKYLSLQQMQE 127
            |||||::||.|  .|.:.|....|:|:||..||||.|||||..|||.|.||||||:||||||||:
  Rat    66 SPDSSSNPKLKLSGPEADEGPEKKEENKVLTKKQKMRTVFSQAQLCALKDRFQRQRYLSLQQMQD 130

Human   128 LSNILNLSYKQVKTWFQNQRMKSKRWQKNNWPKNSNGVTQKASAPT-YPSLYSSYHQGCLVNPTG 191
            ||.|||||||||||||||||||.||||||.|.|.|||:|||.|||. |||::.||.||.|:|.:|
  Rat   131 LSTILNLSYKQVKTWFQNQRMKCKRWQKNQWLKTSNGLTQKGSAPVEYPSIHCSYSQGYLMNASG 195

Human   192 NLPM----------WSNQTWNNSTWSNQTQNIQSWSNHSWNTQTWCTQSWNNQAWN-SPFYNCGE 245
            |||:          |:||||.|.||||||....:|||.:|:||:||||:||:|.|| :|.:|.||
  Rat   196 NLPVWGSQTWTNPTWNNQTWTNPTWSNQTWTNPTWSNQAWSTQSWCTQAWNSQTWNAAPLHNFGE 260

Human   246 ESLQSCMQFQPNSPASDLEAALEAAGEGLNVIQQTTRYFSTPQTMDLFLNYSMNMQPE 303
            :|||..:..|.|..||||||.|||.       :::..:|||||.::||||||:|...|
  Rat   261 DSLQPYVPLQQNFSASDLEANLEAT-------RESQAHFSTPQALELFLNYSVNSPGE 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NANOGNP_079141.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..96 54/97 (56%)
COG5576 74..191 CDD:227863 81/119 (68%)
HOX 95..151 CDD:197696 47/55 (85%)
Required for DNA-binding. /evidence=ECO:0000269|PubMed:25825768 122..151 26/28 (93%)
8 X repeats starting with a Trp in each unit 196..240 27/44 (61%)
Sufficient for transactivation activity. /evidence=ECO:0000250 196..240 27/44 (61%)
Sufficient for strong transactivation activity. /evidence=ECO:0000250 241..305 30/63 (48%)
NanogNP_001094251.1 Homeobox 102..154 CDD:278475 44/51 (86%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C83680149
Domainoid 1 1.000 176 1.000 Domainoid score I27633
eggNOG 1 0.900 - - E1_KOG0491
HGNC 1 1.500 - -
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H78027
Inparanoid 1 1.050 359 1.000 Inparanoid score I13801
NCBI 1 1.000 - -
OMA 1 1.010 - - QHG34640
OrthoDB 1 1.010 - - D1141558at2759
OrthoFinder 1 1.000 - - FOG0012535
OrthoInspector 1 1.000 - - otm52239
orthoMCL 1 0.900 - - OOG6_122116
Panther 1 1.100 - - LDO PTHR24327
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X7335
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1818.270

Return to query results.
Submit another query.