DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAGIX and SPAC167.07c

DIOPT Version :9

Sequence 1:NP_079135.3 Gene:MAGIX / 79917 HGNCID:30006 Length:334 Species:Homo sapiens
Sequence 2:NP_593378.1 Gene:SPAC167.07c / 2542770 PomBaseID:SPAC167.07c Length:1029 Species:Schizosaccharomyces pombe


Alignment Length:114 Identity:26/114 - (22%)
Similarity:40/114 - (35%) Gaps:51/114 - (44%)


- Green bases have known domain annotations that are detailed below.


Human   118 SQASGHFSVELVR----------GYAGFGLTLGGGRDVAGDTPLAV-----RGLLKDGPAQRCGR 167
            :|..||....::|          .:..||..|.|        |:.:     .|::::|       
pombe   665 AQPFGHLKHAVIRRNRIFDDGFDAFYNFGKLLKG--------PIRITFVDEHGVVEEG------- 714

Human   168 LEVGDL-----------VLHIN----GESTQGL----TH--AQAVERIR 195
            ::.|.|           |..||    .|:...|    ||  ||.|||:|
pombe   715 IDGGGLTKEFLTSICKTVFDINYGLFSETKAHLLYPNTHAYAQDVERLR 763

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAGIXNP_079135.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26
PDZ_signaling 124..206 CDD:238492 23/108 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 209..306
SPAC167.07cNP_593378.1 HUL4 155..1029 CDD:227354 26/114 (23%)
HECTc 676..1027 CDD:238033 23/103 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.