DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BTNL8 and side

DIOPT Version :9

Sequence 1:NP_001035552.1 Gene:BTNL8 / 79908 HGNCID:26131 Length:500 Species:Homo sapiens
Sequence 2:NP_001247334.1 Gene:side / 43300 FlyBaseID:FBgn0016061 Length:986 Species:Drosophila melanogaster


Alignment Length:533 Identity:110/533 - (20%)
Similarity:178/533 - (33%) Gaps:171/533 - (32%)


- Green bases have known domain annotations that are detailed below.


Human    24 PDKPVQALVGEDAAFSCFLSPKTNAEAMEVRFFRGQFSSVVHLYRDGKDQPFMQMPQYQGRTKL- 87
            |.:.|.|.:|:.....|.|:|.|:.:::::..:          ::|....|...:....|..|| 
  Fly    96 PARLVWAALGKTVELPCDLTPPTSQDSVKLLLW----------FKDTTGIPLYSLDSRGGNVKLA 150

Human    88 ----------------VKDSIAEGRISLRLENITVLDAGLYGCRIS-----SQSY---------- 121
                            :.|:..:.|  |::.::...|.|:|.||:.     ::::          
  Fly   151 PHAAIASDLGQRLFFSIGDNPKDSR--LQINDVKPEDGGVYRCRVDFFNSPTRNFRHNLTLVVPP 213

Human   122 YQKAIWELQVSALGSVPLISITGYVDRDIQLLCQSSGWFPRPTAKWKGPQGQDLSTDSRTNRDMH 186
            .:..|::.|...:..:......||   ::.|.||..|..|.|...|.....:.:.| |.|:    
  Fly   214 EEPRIFDAQGKEISQMAGPFREGY---ELFLCCQVRGGRPPPKVTWWRDDTELIGT-SHTS---- 270

Human   187 GLFDVEISLTVQENAGSISCSMRHAHLSREVESRVQIGDTFFEPISWHLATKVLGILCCGLFFGI 251
                ||...||..|                   ::.||.|..:                  |:||
  Fly   271 ----VEEGATVMVN-------------------QLLIGTTTRD------------------FYGI 294

Human   252 VGLKIFFSKFQWKIQAELDWRRKHGQAELRDARKH-AVEVTLDP---ETAHPKLCVSDLKTVTHR 312
                        :|:.     |..|...:...||. .|:|.|.|   :.|.|    ::|.|    
  Fly   295 ------------RIEC-----RAQGTRLVDPVRKDVTVQVYLKPVRVKIATP----NELLT---- 334

Human   313 KAPQEVPHSEKRFTRKSVVASQSFQAGKHYWEVDGGHNKRWRVGVCRDDVDRRKEYVTLSPDHGY 377
             |.|.:|...:.:        .|:.|.|..|.:||...:...|.|..|..|..   :|.|     
  Fly   335 -AGQPMPIRCESW--------GSYPAAKITWLLDGEPIRNAEVTVHSDKEDGN---ITTS----- 382

Human   378 WVLRL-------NGEHLYFTLNP----------RFISVFPRTPPTKIGVFLDYECGTISFFNIND 425
             :|.|       |.|......||          |.|.|  ..||| :.|.|..|..:........
  Fly   383 -ILTLKVTSENDNAELTCRATNPWFSGGAIEDKRIIRV--AYPPT-VSVHLANEDPSRLVTRAEG 443

Human   426 QSLIYTLTCRFEGLLRP----YIEYPSYNEQNGTPIVICPVTQESEKEASWQRASAIPETSNSES 486
            |::  |..||.:.  ||    |..:.:....:|....|..:|| .|:|::...|.....|.....
  Fly   444 QNV--TFKCRADA--RPPVTSYSWFKNGMRMSGESTEIMHLTQ-LERESAGAYACGATNTEGETR 503

Human   487 SSQAT--TPFLPR 497
            ||..|  ..|.||
  Fly   504 SSSLTLKVQFSPR 516

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BTNL8NP_001035552.1 IG_like 26..131 CDD:214653 21/136 (15%)
Ig_MOG_like 33..132 CDD:143190 20/130 (15%)
SPRY_PRY_C-I_1 289..460 CDD:293968 45/194 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 470..500 8/30 (27%)
sideNP_001247334.1 V-set 95..211 CDD:284989 21/126 (17%)
IG_like 100..211 CDD:214653 20/122 (16%)
Ig 235..301 CDD:299845 25/131 (19%)
Ig 326..408 CDD:299845 25/107 (23%)
IG_like 329..407 CDD:214653 24/103 (23%)
IG_like 435..511 CDD:214653 18/80 (23%)
Ig_2 442..511 CDD:290606 18/73 (25%)
FN3 <700..735 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.