Sequence 1: | NP_001035552.1 | Gene: | BTNL8 / 79908 | HGNCID: | 26131 | Length: | 500 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001188701.2 | Gene: | DIP-eta / 33793 | FlyBaseID: | FBgn0031725 | Length: | 450 | Species: | Drosophila melanogaster |
Alignment Length: | 202 | Identity: | 41/202 - (20%) |
---|---|---|---|
Similarity: | 64/202 - (31%) | Gaps: | 83/202 - (41%) |
- Green bases have known domain annotations that are detailed below.
Human 30 ALVGEDAAFSCF---LSPKTNAEAMEVRFFRGQFSSVVHLYRDGKDQPFMQMPQYQGRTKLVKDS 91
Human 92 IAEGR---ISLRLENITVLDAGLYGCRISSQSYYQKAIWELQVSALGSVPLISITGYVD------ 147
Human 148 ---------------RDIQLLCQSSGWFPRPTAKWKGPQGQDLSTDSRTNRDMHGLFDVEISLTV 197
Human 198 QENAGSI 204 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
BTNL8 | NP_001035552.1 | IG_like | 26..131 | CDD:214653 | 22/106 (21%) |
Ig_MOG_like | 33..132 | CDD:143190 | 20/104 (19%) | ||
SPRY_PRY_C-I_1 | 289..460 | CDD:293968 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 470..500 | ||||
DIP-eta | NP_001188701.2 | Ig | 51..141 | CDD:299845 | 26/123 (21%) |
IG_like | 51..137 | CDD:214653 | 24/119 (20%) | ||
IG_like | 153..237 | CDD:214653 | 14/66 (21%) | ||
Ig | 161..224 | CDD:299845 | 14/58 (24%) | ||
IG_like | 252..335 | CDD:214653 | |||
Ig | 258..333 | CDD:143165 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |