DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BTNL8 and DIP-eta

DIOPT Version :9

Sequence 1:NP_001035552.1 Gene:BTNL8 / 79908 HGNCID:26131 Length:500 Species:Homo sapiens
Sequence 2:NP_001188701.2 Gene:DIP-eta / 33793 FlyBaseID:FBgn0031725 Length:450 Species:Drosophila melanogaster


Alignment Length:202 Identity:41/202 - (20%)
Similarity:64/202 - (31%) Gaps:83/202 - (41%)


- Green bases have known domain annotations that are detailed below.


Human    30 ALVGEDAAFSCF---LSPKTNAEAMEVRFFRGQFSSVVHLYRDGKDQPFMQMPQYQGRTKLVKDS 91
            |.||.||..:|.   |.|      .:|.:.|....:::.:             |....||..:..
  Fly    54 APVGRDAFLTCVVQDLGP------YKVAWLRVDTQTILTI-------------QNHVITKNQRIG 99

Human    92 IAEGR---ISLRLENITVLDAGLYGCRISSQSYYQKAIWELQVSALGSVPLISITGYVD------ 147
            ||...   .::|:::|...|.|.|.|:|::.                  |:.|..||:|      
  Fly   100 IANSEHKTWTMRIKDIKESDKGWYMCQINTD------------------PMKSQMGYLDVVVPPD 146

Human   148 ---------------RDIQLLCQSSGWFPRPTAKWKGPQGQDLSTDSRTNRDMHGLFDVEISLTV 197
                           .::.|.|.::| .|.||..|:...|                  |.|.|..
  Fly   147 ILDYPTSTDMVVREGSNVTLKCAATG-SPEPTITWRRESG------------------VPIELAT 192

Human   198 QENAGSI 204
            .|...||
  Fly   193 GEEVMSI 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BTNL8NP_001035552.1 IG_like 26..131 CDD:214653 22/106 (21%)
Ig_MOG_like 33..132 CDD:143190 20/104 (19%)
SPRY_PRY_C-I_1 289..460 CDD:293968
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 470..500
DIP-etaNP_001188701.2 Ig 51..141 CDD:299845 26/123 (21%)
IG_like 51..137 CDD:214653 24/119 (20%)
IG_like 153..237 CDD:214653 14/66 (21%)
Ig 161..224 CDD:299845 14/58 (24%)
IG_like 252..335 CDD:214653
Ig 258..333 CDD:143165
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.