DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZNF212 and CG6654

DIOPT Version :9

Sequence 1:NP_036388.2 Gene:ZNF212 / 7988 HGNCID:13004 Length:495 Species:Homo sapiens
Sequence 2:NP_650429.1 Gene:CG6654 / 41831 FlyBaseID:FBgn0038301 Length:639 Species:Drosophila melanogaster


Alignment Length:551 Identity:124/551 - (22%)
Similarity:187/551 - (33%) Gaps:138/551 - (25%)


- Green bases have known domain annotations that are detailed below.


Human    18 LTSSTLPSQATEKSSYFQTTEISLWTVVAAIQAVEKKMESQAARLQSLEGRTGTAEKKLADCEKM 82
            |..:.||.:...|.|    ....:.|...|:|....:.:...|.:|: :..|.|..::.....|.
  Fly    79 LLPNALPEEPDSKVS----ISCPVATTDQAVQTTSWEPDRCTASVQT-DAVTTTDAEQNTSLIKS 138

Human    83 AVEFGNQLEGKWAVLGTLLQEYGLLQRRLENVENLLRNRNFWILRLPPGSKGEAPKVSRSLENDG 147
            .:......||:..|.     :|.|....:|...:|       ||::....|.|..          
  Fly   139 TISVDLDYEGEGEVF-----DYELPDEPVEKTTSL-------ILQVQGNLKDEKE---------- 181

Human   148 VCFTEQEWENL--EDWQKELYRNVMESNYETLVSLKVLGQTEGEAELGTEMLGDLEEEGPGGAHP 210
            |.||:   .|:  |....||.:.:.|.|      |.:....:.|||:.|.....:.      ...
  Fly   182 VVFTQ---TNVIYEGDDHELEQQIRECN------LAIFEGVDNEAEIITVTAPQVT------TRK 231

Human   211 AGGVMIKQELQYTQEGPADLPGEFSCIAEEQAFLSPEQTELWGGQGSSVLLETGPGDS------- 268
            :...::.|:.....:.|.....|...:.:||...|.::|....|.....:..|.|.|:       
  Fly   232 SAAKLLTQQENDKHQTPVGSKEEARELEKEQVPQSAKRTSRRRGVVKQDVPATPPSDAEPSPKQH 296

Human   269 ------TLEEPVGSRVPSSSRTVGC---PKQKSHRQVQLDQECGQGLKLKKD----------TSR 314
                  .|..|....|...|.|.|.   |:.|.|     ...|..|..::|.          .:|
  Fly   297 RLGTQRKLSAPRAGTVNGPSTTSGAATTPELKYH-----CDRCNAGFAVEKSLMIHRRQKGCINR 356

Human   315 PYECSECEITFRYKQQLATHLRSHSGWGSCTPE-----EPEE----------------------- 351
            .|:|:|||..|.....||.|..|| |..:| ||     :.:|                       
  Fly   357 NYKCNECEKVFVSPDHLAEHQASH-GAHNC-PECGIRCDSKEALSKHMVQGHKRNLRNQCNICQK 419

Human   352 ------SLRPRPRL-------------KPQTKKAKLHQ------------CDVCLRSFSCKVSLV 385
                  :||...|:             |..|:.|.|.|            |::|..||..|..|.
  Fly   420 VFTMLSTLRDHMRIHTGEKPFVCNICGKSFTQNANLRQHKLRHSETKSFKCELCPHSFVTKAELT 484

Human   386 THQRCHLQEGPSAGQHVQERFSPNSLVALPGHIPWRKSRSSLICGYCGKSFSHPSDLVRHQRIHT 450
            :|.|.|..:.|...:....||:.:  .:|..|...........|..|...|:..:.|..|:|.||
  Fly   485 SHARTHTGDKPFECEVCLARFTTS--CSLAKHKRKHTGERPYACDLCPMRFTALNVLKNHRRTHT 547

Human   451 GERPYSCTECEKSFVQKQHLLQHQKIHQRER 481
            |||||.|..|.|:|.|:.....||:.||.||
  Fly   548 GERPYVCPFCSKTFTQRGDCQMHQRTHQGER 578

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZNF212NP_036388.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..29 3/10 (30%)
KRAB_A-box 142..180 CDD:143639 9/39 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 264..290 9/41 (22%)
C2H2 Zn finger 318..338 CDD:275370 8/19 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 337..361 10/70 (14%)
COG5048 <367..479 CDD:227381 37/123 (30%)
C2H2 Zn finger 371..391 CDD:275368 8/19 (42%)
C2H2 Zn finger 429..449 CDD:275368 6/19 (32%)
zf-C2H2 429..449 CDD:306579 6/19 (32%)
zf-H2C2_2 441..466 CDD:316026 14/24 (58%)
C2H2 Zn finger 457..477 CDD:275368 7/19 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 476..495 4/6 (67%)
CG6654NP_650429.1 zf-AD 6..79 CDD:285071 124/551 (23%)
C2H2 Zn finger 331..354 CDD:275368 3/22 (14%)
COG5048 <357..570 CDD:227381 56/216 (26%)
C2H2 Zn finger 360..380 CDD:275368 8/19 (42%)
C2H2 Zn finger 385..406 CDD:275370 4/21 (19%)
C2H2 Zn finger 414..434 CDD:275368 3/19 (16%)
zf-H2C2_2 427..451 CDD:290200 4/23 (17%)
C2H2 Zn finger 442..490 CDD:275368 13/47 (28%)
C2H2 Zn finger 470..487 CDD:275368 6/16 (38%)
zf-H2C2_2 482..507 CDD:290200 7/24 (29%)
C2H2 Zn finger 498..518 CDD:275368 4/21 (19%)
zf-H2C2_2 510..534 CDD:290200 4/23 (17%)
C2H2 Zn finger 526..546 CDD:275368 6/19 (32%)
zf-H2C2_2 539..563 CDD:290200 14/23 (61%)
C2H2 Zn finger 554..574 CDD:275368 7/19 (37%)
C2H2 Zn finger 582..602 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.