DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZDHHC11 and CG4956

DIOPT Version :9

Sequence 1:XP_016865358.1 Gene:ZDHHC11 / 79844 HGNCID:19158 Length:559 Species:Homo sapiens
Sequence 2:NP_651428.2 Gene:CG4956 / 43114 FlyBaseID:FBgn0039370 Length:302 Species:Drosophila melanogaster


Alignment Length:362 Identity:71/362 - (19%)
Similarity:119/362 - (32%) Gaps:147/362 - (40%)


- Green bases have known domain annotations that are detailed below.


Human    38 LHYFQVVTWAVFVGLSSATFGIFIPFL---------PHA-WKYIAYVVTGGIFSFHLVVHLIAS- 91
            ||.|..:.....:||      :|:..|         ||. |..:.:.:  ||::   |::::.: 
  Fly    41 LHPFCAIFLLCLIGL------LFVYELCYVLPQITDPHGIWHKLCWFM--GIYT---VINILGNW 94

Human    92 ---CIDPADSNVRLMKNYSQPMPLFDR----SKHAHVIQNQFCHLCKVTVPQHPPPASHSLLDAL 149
               |          |.|.|....:.:|    :..||:.  .:|..|:                  
  Fly    95 WLGC----------MTNTSVDSLVLERQYPVAGEAHLW--HYCSTCQ------------------ 129

Human   150 SPGRTGLVPPRHLASSDGPLALPQPAHLGPDRRSPIHPSRNKKTKHCISCNKCVSGFDHHCKWIN 214
                 .|||||                                :.||..||.|:...||||.:..
  Fly   130 -----KLVPPR--------------------------------SWHCSLCNICILKRDHHCTFFA 157

Human   215 NCVGSRNYWFFFSTVASATAG---MLCLIAILLYVLVQYL-VNPGVLRTDPRYEDVK-------- 267
            :|:|.:|..:|.:.:...:.|   .|....||.:....:| |:|.:|......:|..        
  Fly   158 SCIGHKNQRYFLAFLFHLSFGSGQALVYNGILNWTNKAFLVVDPLLLMFQDTTQDADFKWKYTIA 222

Human   268 ---NMNTWLLFLPLFPVQVQTLIVVIIGMLVLLLD---------FLGLVHLGQLLIFHIYLSMSP 320
               .:|.:|..:|||....|.::|........:||         ...:| ||:.   ..::..||
  Fly   223 NLFKLNLFLFGVPLFMFVFQMIMVYRNSTCYKMLDRSYDVGWRRNFDMV-LGKR---RFWIFFSP 283

Human   321 TLSPRSPQGWVVRAAHLTPLLEYVPNPEPPTPGARVF 357
            |:|              :||         ||.|.:.|
  Fly   284 TIS--------------SPL---------PTDGTQWF 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZDHHC11XP_016865358.1 None
CG4956NP_651428.2 zf-DHHC 123..251 CDD:279823 36/182 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.