DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZDHHC11 and CG17197

DIOPT Version :9

Sequence 1:XP_016865358.1 Gene:ZDHHC11 / 79844 HGNCID:19158 Length:559 Species:Homo sapiens
Sequence 2:NP_651425.2 Gene:CG17197 / 43111 FlyBaseID:FBgn0039367 Length:290 Species:Drosophila melanogaster


Alignment Length:334 Identity:75/334 - (22%)
Similarity:121/334 - (36%) Gaps:107/334 - (32%)


- Green bases have known domain annotations that are detailed below.


Human    41 FQVVTWAVFVGLSSATFGIF--IP--FLPHAWKY-----IAYVVTGGIFSFHLVVHLIASCID-- 94
            |.:||...||.|.     :|  :|  |....:.|     :|..:|..||...|..|:.::.::  
  Fly    30 FVIVTTIFFVVLQ-----MFYVVPQLFDVQGFMYKLGWLVAIFITYNIFGNMLACHITSTSVESL 89

Human    95 PADSNVRLMKNYSQPMPLFDRSKHAHVIQNQFCHLCKVTVPQHPPPASHSLLDALSPGRTGLVPP 159
            |.|..:        |.|..:...|       :|.:|:                       .|:||
  Fly    90 PKDRQI--------PEPEEEHQWH-------YCDVCE-----------------------KLMPP 116

Human   160 RHLASSDGPLALPQPAHLGPDRRSPIHPSRNKKTKHCISCNKCVSGFDHHCKWINNCVGSRN--- 221
            |                                :.|||.|..|:...|.||.:..:|||..|   
  Fly   117 R--------------------------------SWHCILCKCCILKRDRHCIFTASCVGHNNQRY 149

Human   222 -YWF-FFSTVASATAGMLCLIAILLYVLVQYLVNPGVLRTD-PRYEDVKN--MNTWLLFLPLFPV 281
             :|| .|..:.:..|....:||.|.|.....|:...:.|.: |.:..|..  :||::...|:..|
  Fly   150 FFWFTLFMALGTGVALATHIIATLKYFSYSDLIFLNIPRDNLPPFWLVITLILNTYVFAAPVSSV 214

Human   282 QVQTLIVVIIGMLVLLLD---FLGLVHLGQLLI----FHIYLSMSPTL-SPRSPQG--W-VVRAA 335
            .:|..::...|.|.....   .|||....:|::    |..:|  |||: ||....|  | :.|..
  Fly   215 LMQLSVLKNNGTLHKFYSDTYDLGLWENFKLILGGKGFWTFL--SPTVKSPLPHDGAQWKIKRVQ 277

Human   336 HLTPLLEYV 344
            |.:|.|:::
  Fly   278 HHSPKLQFL 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZDHHC11XP_016865358.1 None
CG17197NP_651425.2 PHA02688 <9..70 CDD:222919 11/44 (25%)
zf-DHHC 100..>198 CDD:279823 30/159 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.