| Sequence 1: | XP_016865358.1 | Gene: | ZDHHC11 / 79844 | HGNCID: | 19158 | Length: | 559 | Species: | Homo sapiens |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001261910.1 | Gene: | Hip14 / 39747 | FlyBaseID: | FBgn0259824 | Length: | 655 | Species: | Drosophila melanogaster |
| Alignment Length: | 210 | Identity: | 50/210 - (23%) |
|---|---|---|---|
| Similarity: | 83/210 - (39%) | Gaps: | 80/210 - (38%) |
- Green bases have known domain annotations that are detailed below.
|
Human 182 RSPIHPSRNKKTKHCISCNKCVSGFDHHCKWINNCVGSRNYWFFFSTVASATAGMLCLIAILLYV 246
Human 247 LVQYLVNPGVLRTDPRYED-------VKNMN--------------TWLLFLPLFPVQVQTLIVVI 290
Human 291 IGM---------------------------LVLLLDFL-----GLVHLGQLLIFHIY-------- 315
Human 316 -LSMSPTLSPRSPQG 329 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| ZDHHC11 | XP_016865358.1 | None | |||
| Hip14 | NP_001261910.1 | ANK | 52..165 | CDD:238125 | |
| Ank_2 | 52..142 | CDD:289560 | |||
| ANK repeat | 77..108 | CDD:293786 | |||
| ANK repeat | 110..142 | CDD:293786 | |||
| ANK | 114..233 | CDD:238125 | |||
| Ank_2 | 116..209 | CDD:289560 | |||
| ANK repeat | 144..175 | CDD:293786 | |||
| ANK repeat | 177..209 | CDD:293786 | |||
| Ank_5 | 198..251 | CDD:290568 | |||
| ANK repeat | 212..244 | CDD:293786 | |||
| zf-DHHC | 426..559 | CDD:279823 | 37/138 (27%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_COG5273 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||