DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZDHHC11 and app

DIOPT Version :9

Sequence 1:XP_016865358.1 Gene:ZDHHC11 / 79844 HGNCID:19158 Length:559 Species:Homo sapiens
Sequence 2:NP_648561.2 Gene:app / 39399 FlyBaseID:FBgn0260941 Length:755 Species:Drosophila melanogaster


Alignment Length:436 Identity:93/436 - (21%)
Similarity:146/436 - (33%) Gaps:139/436 - (31%)


- Green bases have known domain annotations that are detailed below.


Human    44 VTWAVFVGLSSATFGIFIPFLPHAWKYIAYVVTGGIFSFHLVVHLIASCIDPA-------DSNVR 101
            :|..:..|.|:..|....|||..:......:|...::.|.:...|..:..||.       |....
  Fly    48 LTCILITGTSALFFAFDCPFLADSINPAIPIVGAVLYFFTMSSLLRTTFTDPGVIPRASNDEAAY 112

Human   102 LMKNYSQPMPLFD-------RSKHAHV----IQNQFCHLCKVTVPQHPPPASHSLLDALSPGRTG 155
            :.|....|..|..       |:|...|    ::.::|..||:.   .||.||             
  Fly   113 IEKQIEVPNSLNSPTYRPPPRTKEVLVKGQTVKLKYCFTCKIF---RPPRAS------------- 161

Human   156 LVPPRHLASSDGPLALPQPAHLGPDRRSPIHPSRNKKTKHCISCNKCVSGFDHHCKWINNCVGSR 220
                                                   ||..|:.||..|||||.|:.||||.|
  Fly   162 ---------------------------------------HCSLCDNCVDRFDHHCPWVGNCVGKR 187

Human   221 NYWFFFSTVASATAGMLCLIAILLY-VLVQYLVNPGVLRTDPRYEDVKNMNTWLLFLPLFPVQVQ 284
            ||.||:..:.|     |..:|:.:: ..|.:|    ||.....:| |.|:.....|         
  Fly   188 NYRFFYLFLVS-----LAFLAVFIFSCSVTHL----VLLMKKEHE-VFNVIKAAPF--------- 233

Human   285 TLIVVIIGMLVLLLDFLGLVHLGQLLIFHIYLSMSPTLSPRSPQGWVVRAAHLTPLLEYVPNPEP 349
            |:|||.| ....:...:||..      ||.||:.|...:....:|.......        |..:.
  Fly   234 TVIVVFI-CFFSIWSVIGLAG------FHTYLTTSDQTTNEDLKGSFSSKGG--------PRTQN 283

Human   350 PTPGARVFVPRVRMCSGSASPRSEIMDKKGKSQEEIKSMRTQQAQQEAELTPRPAGVVPEAKKMT 414
            |.....:.:....:..|..:|  .::|::|.:.:|.    .||.|.::  :||.|          
  Fly   284 PYSRGNICLNCCHILCGPMTP--SLIDRRGIATDEF----IQQMQHQS--SPRHA---------- 330

Human   415 TFEYLINNRKEESSKHQAVRKDPYVQMDKGVLQQGAGALGSSAQGV 460
            ..:.|       |:.|......|.:    |.|  |.|.:|.:..|:
  Fly   331 LSDVL-------SASHMVTTSQPMM----GGL--GGGGIGGAGGGI 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZDHHC11XP_016865358.1 None
appNP_648561.2 zf-DHHC 146..270 CDD:279823 50/204 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.