DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZDHHC11 and CG10344

DIOPT Version :9

Sequence 1:XP_016865358.1 Gene:ZDHHC11 / 79844 HGNCID:19158 Length:559 Species:Homo sapiens
Sequence 2:NP_611671.1 Gene:CG10344 / 37565 FlyBaseID:FBgn0034729 Length:278 Species:Drosophila melanogaster


Alignment Length:338 Identity:69/338 - (20%)
Similarity:108/338 - (31%) Gaps:117/338 - (34%)


- Green bases have known domain annotations that are detailed below.


Human    57 FGIFIPFLPHAWKYIAYVV------TGGIFSFHLVVHLIASCIDPADSNVRLMKNYSQPMPLFDR 115
            |.|...|||..:.:...||      .||.  ||....|:|..:      |..:|.......:.|.
  Fly    18 FLIIAVFLPVVFMFEIVVVLPAFHEPGGF--FHTFTFLMAMFL------VFNIKGNMIACMMIDT 74

Human   116 SKHAHVIQNQFCHLCKVTVPQHPPPASHSLLDALSPGRTG----LVPPRHLASSDGPLALPQPAH 176
            |               |.|.:..||:     |.|:....|    |.|||                
  Fly    75 S---------------VNVKKVEPPS-----DQLNWRECGECQKLAPPR---------------- 103

Human   177 LGPDRRSPIHPSRNKKTKHCISCNKCVSGFDHHCKWINNCVGSRNYWFFFSTVASATAGMLCLIA 241
                            :.||.:|..|:...||||.:...|:|.||:.||...:.....|.   :.
  Fly   104 ----------------SWHCKACKVCILKRDHHCIYTGCCIGLRNHRFFMGFIFYLFVGS---VY 149

Human   242 ILLYVLVQYLVNPGVLRTDPRYEDVKNMNTWLLFLPLFPVQVQTLIVVIIG-------MLVLLLD 299
            .|:|..:...|..|.:           .:.|:..|.|    ...::.::.|       ::...|:
  Fly   150 ALVYNSIYMWVIHGHI-----------YSNWVTVLKL----ACPMLHLVTGSFWTNMYLVFYSLN 199

Human   300 FLGLVHLGQLLIFHIYLSMSPTLSP------------------RSPQGWVVRAAHLTPLLEYVPN 346
            .|.|.:...||.:|:.:.:...:|.                  ||..|..:..|.|:||:    .
  Fly   200 ILALAYGVLLLAYHVPIVLRGGVSADRTKESKEKYDRGVYQNLRSVFGNRMHLAWLSPLI----R 260

Human   347 PEPPTPGARVFVP 359
            .:.|..|....||
  Fly   261 SDLPEDGYHWNVP 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZDHHC11XP_016865358.1 None
CG10344NP_611671.1 zf-DHHC 93..220 CDD:279823 34/176 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.