DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZDHHC11 and CG17287

DIOPT Version :9

Sequence 1:XP_016865358.1 Gene:ZDHHC11 / 79844 HGNCID:19158 Length:559 Species:Homo sapiens
Sequence 2:NP_611197.1 Gene:CG17287 / 36939 FlyBaseID:FBgn0034202 Length:338 Species:Drosophila melanogaster


Alignment Length:124 Identity:31/124 - (25%)
Similarity:57/124 - (45%) Gaps:19/124 - (15%)


- Green bases have known domain annotations that are detailed below.


Human   185 IHPSRNKKTKHCISCNKCVSGFDHHCKWINNCVGSRNYWFFFSTVASATAGMLCLIAILLYVLVQ 249
            |.|.|   ..||.:|:.||...||||.||.|||...|:.:|...:..|......|..:::|.|  
  Fly   133 IKPDR---AHHCRTCHMCVLKMDHHCPWIVNCVHFHNFKYFILFLFYAEVYCFYLFCVMVYDL-- 192

Human   250 YLVNPGVLRTDPRYEDVKNMNTWLLFLPLFPVQVQTLIVVIIGMLVLLLDFLGLVHLGQ 308
            ||:      .......:||.::|.:        :|.|:.::..:..:::..:.|:::.:
  Fly   193 YLI------CGFEVTALKNQHSWNI--------LQYLVCILFNIFTVIMYTVSLLNVSR 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZDHHC11XP_016865358.1 None
CG17287NP_611197.1 zf-DHHC 125..243 CDD:279823 31/124 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157911
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.