DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZDHHC11 and CG4676

DIOPT Version :9

Sequence 1:XP_016865358.1 Gene:ZDHHC11 / 79844 HGNCID:19158 Length:559 Species:Homo sapiens
Sequence 2:NP_610853.1 Gene:CG4676 / 36465 FlyBaseID:FBgn0033815 Length:284 Species:Drosophila melanogaster


Alignment Length:300 Identity:63/300 - (21%)
Similarity:100/300 - (33%) Gaps:133/300 - (44%)


- Green bases have known domain annotations that are detailed below.


Human    59 IFIPFLPHAWKYIAYV--------VTGGIF-----------SFHLVVHLIASCIDPADSNVR--L 102
            :|:|.     .||.:|        ..|||:           .|::..:::|..:  .|:::|  |
  Fly    26 VFVPV-----TYIFHVTIVMPELFAIGGIWYTLLWLASLFLIFNITSNMLACML--VDTSIRKEL 83

Human   103 MKNYSQPMPLFDRSKHAHVIQNQFCHLCKVTVPQHPPPASHSLLDALSPGRTGLVPPRHLASSDG 167
            :|      |..|.::.|.                     .||..|..:     |||||       
  Fly    84 LK------PPLDAAQLAR---------------------WHSCQDCQT-----LVPPR------- 109

Human   168 PLALPQPAHLGPDRRSPIHPSRNKKTKHCISCNKCVSGFDHHCKWINNCVGSRNYWFFFSTVASA 232
                                     :.||..||.||...||||::...|:|..||.:||      
  Fly   110 -------------------------SWHCEVCNVCVLKRDHHCRFTCCCIGHHNYRYFF------ 143

Human   233 TAGMLCLIAILLYVLVQYLVNPGVLRTDPRYEDVKNMNTWLLFLPLFPVQVQTLIVVIIGMLVLL 297
                        |.||..::  |.|..    ..::::..|.|.|.:: .:..||..:...::.|:
  Fly   144 ------------YYLVYMII--GSLAA----AIMESIYLWHLHLDIY-WRWSTLFTIFAPVVSLM 189

Human   298 LD--------------FLGLVHLGQLLIFH--IYLSMSPT 321
            |.              .||......||:||  |:.|.|.|
  Fly   190 LSPSWESFYLVIYDLTLLGFAISSLLLVFHWSIFKSGSVT 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZDHHC11XP_016865358.1 None
CG4676NP_610853.1 zf-DHHC 99..232 CDD:279823 43/192 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.