DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZDHHC11 and Dnz1

DIOPT Version :9

Sequence 1:XP_016865358.1 Gene:ZDHHC11 / 79844 HGNCID:19158 Length:559 Species:Homo sapiens
Sequence 2:NP_477449.1 Gene:Dnz1 / 34503 FlyBaseID:FBgn0027453 Length:276 Species:Drosophila melanogaster


Alignment Length:325 Identity:67/325 - (20%)
Similarity:110/325 - (33%) Gaps:103/325 - (31%)


- Green bases have known domain annotations that are detailed below.


Human    56 TFG--IFIPFLPHAWKYIAYVVTGGIF-SFHLVV-----------HLIASCIDPADSNVRLMKNY 106
            |:|  ::..::...| .|...:.|.:: |||:|:           |..|...||.          
  Fly    16 TYGAVLYADYVVIRW-IILTTMPGSLWMSFHVVLFNTVVFLLAMSHSKAVFSDPG---------- 69

Human   107 SQPMPLFDRSKHAHVIQNQFCHLCKVTVPQHPPPAS-HSLLDALSPGRTGLVPPRHLASSDGPLA 170
            :.|:|       |:.:.....|   .|...:|||.: ||....:........|||          
  Fly    70 TVPLP-------ANRLDFSDLH---TTNKNNPPPGNGHSSEWTVCTRCETYRPPR---------- 114

Human   171 LPQPAHLGPDRRSPIHPSRNKKTKHCISCNKCVSGFDHHCKWINNCVGSRNYWFFFSTVASATAG 235
                ||                  ||..|.:|:...||||.|||||||.||..:|..        
  Fly   115 ----AH------------------HCRICKRCIRRMDHHCPWINNCVGERNQKYFLQ-------- 149

Human   236 MLCLIAILLYVLVQYLVNPGVLRTDPRYEDVKNMNTWLLFLPLFPVQVQTLIVVIIGMLV--LLL 298
            .|..:|:|....:..:|...|...:...::|....     |.:....:..|:..:.|:.|  :::
  Fly   150 FLIYVALLSLYSIALIVGSWVWPCEECSQNVIETQ-----LRMIHSVILMLVSALFGLFVTAIMV 209

Human   299 DFLGLVHLGQLLIFHI------------YLSMSPTLSPRSPQGWVVRAA--------HLTPLLEY 343
            |.|..:...:..:..|            |..::.......|..|::...        |.||||.:
  Fly   210 DQLHAILYDETAVEAIQQKGTYRPNRRKYQLLADVFGRGHPALWLLPCTSLNHASRYHDTPLLSH 274

Human   344  343
              Fly   275  274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZDHHC11XP_016865358.1 None
Dnz1NP_477449.1 DHHC 97..228 CDD:396215 38/175 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157931
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.