DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZDHHC11 and Zdhhc8

DIOPT Version :9

Sequence 1:XP_016865358.1 Gene:ZDHHC11 / 79844 HGNCID:19158 Length:559 Species:Homo sapiens
Sequence 2:NP_001259382.1 Gene:Zdhhc8 / 31887 FlyBaseID:FBgn0085478 Length:1052 Species:Drosophila melanogaster


Alignment Length:289 Identity:64/289 - (22%)
Similarity:104/289 - (35%) Gaps:122/289 - (42%)


- Green bases have known domain annotations that are detailed below.


Human    46 WAVFVGLSSATFGIFIPFLP-------HAWKYIAYVVTGGIFSFHLVVHL-IASCIDPA------ 96
            |.|   |...||..|  |.|       |.| .:||   .|:.:|.::.:. :|:.:||.      
  Fly    17 WIV---LLLTTFLFF--FYPCQFYVKSHPW-VLAY---QGVITFFVLANFTLATFMDPGIIPKAS 72

Human    97 ---DSNVRLMKNYSQPMPLFDRSKHAHV----IQNQFCHLCKVTVPQHPPPASHSLLDALSPGRT 154
               |....|.      .||:   |:|.:    ::.::|..||.    :.||              
  Fly    73 PDEDCEEELR------APLY---KNAEINGITVKMKWCVTCKF----YRPP-------------- 110

Human   155 GLVPPRHLASSDGPLALPQPAHLGPDRRSPIHPSRNKKTKHCISCNKCVSGFDHHCKWINNCVGS 219
                                                 :..||..||.|:..|||||.|:|||:|.
  Fly   111 -------------------------------------RCSHCSVCNHCIETFDHHCPWVNNCIGR 138

Human   220 RNYWFFFSTVASATAGMLCLIAI-LLYVLVQYLVNPGVLRTDPRYEDVKNMNTWLLFLPLFPVQV 283
            |||.|||..:.|.:..||.:.:: |:|||   .:.|.:..|.|                      
  Fly   139 RNYRFFFFFLVSLSIHMLSIFSLCLVYVL---KIMPNIKDTAP---------------------- 178

Human   284 QTLIVVIIGML-VLLLDFLGLVHLGQLLI 311
             .:.::::|:: :|.:...||.....:|:
  Fly   179 -IVAIILMGLVTILAIPIFGLTGFHMVLV 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZDHHC11XP_016865358.1 None
Zdhhc8NP_001259382.1 zf-DHHC 94..219 CDD:279823 41/194 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.