DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment taok3a and Pak

DIOPT Version :9

Sequence 1:XP_009299531.1 Gene:taok3a / 798408 ZFINID:ZDB-GENE-100921-50 Length:903 Species:Danio rerio
Sequence 2:NP_001138013.2 Gene:Pak / 44039 FlyBaseID:FBgn0267698 Length:840 Species:Drosophila melanogaster


Alignment Length:287 Identity:119/287 - (41%)
Similarity:167/287 - (58%) Gaps:16/287 - (5%)


- Green bases have known domain annotations that are detailed below.


Zfish    24 DPEEVFCDLHEIGHGSFGAVYFARNSYSNEVVAIKKMSYNGKQTTEKWQDIIKEVKFLEQLRHPN 88
            ||...:..:.:||.|:.|.||.|..|.:...||||:|:.:.:...|.   ||.|:..:.:.:|||
  Fly   561 DPNRKYTKMEKIGQGASGTVYTAIESSTGMEVAIKQMNLSQQPKKEL---IINEILVMRENKHPN 622

Zfish    89 TIEYKGCYLKDNTAWLVMEYCL-GSASDLLEVHKKPLQEVEIAAITHGALLGLAYLHSHNMIHRD 152
            .:.|...||.....|:||||.. ||.:|:  |.:..:.|.:|||:....|..|.:||::.:||||
  Fly   623 VVNYLDSYLVSEELWVVMEYLPGGSLTDV--VTETCMDEGQIAAVCREVLQALEFLHANQVIHRD 685

Zfish   153 VKAGNILLTEPGQVKLADFGSASIASPANS----FVGTPYWMAPEVILAMDEGQYEGKVDIWSLG 213
            :|:.||||...|.|||.|||..:..||..|    .|||||||||||:   ...||..|||:||||
  Fly   686 IKSDNILLGLDGSVKLTDFGFCAQISPEQSKRTTMVGTPYWMAPEVV---TRKQYGPKVDLWSLG 747

Zfish   214 ITCIELAERKPPLFNMNAMSALYHIAQNDSPTL-QSNEWSDAFRSFVDYCLLKIPQDRPSSA-EL 276
            |..||:.|.:||..|.|.:.|||.||.|..|.: :.::.|.||:.|:|.| |::..||.:|| :|
  Fly   748 IMAIEMVEGEPPYLNENPLKALYLIATNGKPEIKEKDKLSSAFQDFLDQC-LEVEVDRRASALDL 811

Zfish   277 LRHEFVRRDRPLRVLIDLIQRTKDAVR 303
            |:|.|::..|||..|..||...|:|.:
  Fly   812 LKHPFLKLARPLASLTPLIMAAKEATK 838

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
taok3aXP_009299531.1 PKc_like 7..319 CDD:304357 119/287 (41%)
S_TKc 29..282 CDD:214567 108/259 (42%)
PakNP_001138013.2 PBD 83..137 CDD:279166
STKc_PAK_I 558..818 CDD:270814 111/265 (42%)
S_TKc 566..817 CDD:214567 108/259 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.