DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PIP4K2C and PIP5K59B

DIOPT Version :9

Sequence 1:NP_001139730.1 Gene:PIP4K2C / 79837 HGNCID:23786 Length:421 Species:Homo sapiens
Sequence 2:NP_001369113.1 Gene:PIP5K59B / 37633 FlyBaseID:FBgn0034789 Length:891 Species:Drosophila melanogaster


Alignment Length:404 Identity:120/404 - (29%)
Similarity:206/404 - (50%) Gaps:52/404 - (12%)


- Green bases have known domain annotations that are detailed below.


Human    47 LVGVFLWGVAHSINELSQVPPPVMLLPDDFKASSKIKVNNHLFHREN---LPSH----FKFKEYC 104
            ::|....|:.|::..|:..|...:|:.|.:      ::.:..|..|.   .|:|    |::|.|.
  Fly    80 IMGSIQLGIQHTVGSLASKPKRDLLMMDFW------EIESITFPPEGSSLTPAHHYSEFRYKIYA 138

Human   105 PQVFRNLRDRFGIDDQDYLVSLTRNPPSE--SEGSDGR-FLISYDRTLVIKEVSSEDIADMHSNL 166
            |..||..||.|||...|:::|:..:|..|  :.|:.|. |.::.|...:||.|..::...:...|
  Fly   139 PIAFRYFRDLFGIQPDDFMMSMCTSPLRELSNPGASGSIFYLTTDDEFIIKTVQHKEGEFLQKLL 203

Human   167 SNYHQYIVKCHGNTLLPQFLGMYRVSVDN-EDSYMLVMRNMFSHRLPVHRKYDLKGSLVSREASD 230
            ..|:..:.: :..||||:|.|:|.:...| ::..::||.|:....:.:|.|||||||...|:|:.
  Fly   204 PGYYMNLNQ-NPRTLLPKFFGLYCLQTSNAKNIRLVVMNNLLPSSVKMHLKYDLKGSTFKRKANK 267

Human   231 KEKVKELPTLKDMDFLNKNQK-VYIGEEEKKIFLEKLKRDVEFLVQLKIMDYSLLLGIHDI---I 291
            .|:.|:.||.||:||:.::.. :::..|.....::.::||...|...||||||||||:|::   :
  Fly   268 AERAKKSPTYKDLDFMEQHPNGIFLEAETYAALIKTIQRDCTVLESFKIMDYSLLLGVHNLDVAL 332

Human   292 RGSEPEEEAPVR---EDESEVDGDCSLTGPPA-------------LVGSYGTSPEGIGGY---IH 337
            :..:.|:..|:|   .::|:||.|..|.|..|             || ::.|:.|.|...   |.
  Fly   333 KEKQSEQRKPLRAPLAEDSDVDADDPLDGDAATGISRNKSVNRQRLV-AHSTAMESIQAESEPID 396

Human   338 SHRPLGPGEFESFIDVYAIRSAEGAPQKEVYFMGLIDILTQYDAKKKAAHAAKTVKHGAGAEIST 402
            ....:.||...:       ||.:|  ::.:.::|:||||..|..|||..|..|::.|. |..:|.
  Fly   397 DEEDVPPGGIPA-------RSEKG--ERLLLYIGIIDILQSYRLKKKLEHTFKSIIHD-GETVSV 451

Human   403 VHPEQYAKRFLDFI 416
            ..|..||:||.:|:
  Fly   452 CRPSFYAQRFQNFM 465

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PIP4K2CNP_001139730.1 Required for interaction with PIP5K1A. /evidence=ECO:0000269|PubMed:31091439 69..75 1/5 (20%)
PIPKc 72..420 CDD:214623 114/379 (30%)
PIP5K59BNP_001369113.1 PIPKc_PIP5KI 78..473 CDD:340438 120/404 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5253
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1562683at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.